MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. Biochemistry (0006-2960) 2006 Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B partial coverage rapid curation in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B PTP1B PTP1B PTP1B Biochemistry (0006-2960) 2006 partial coverage rapid curation Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. Biochemistry (0006-2960) 2006 Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B partial coverage rapid curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B PTP1B PTP1B PTP1B Biochemistry (0006-2960) 2006 partial coverage rapid curation Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. Biochemistry (0006-2960) 2006 Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B partial coverage rapid curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphatase assay phosphatase assay predetermined predetermined participant predetermined Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B PTP1B PTP1B PTP1B Biochemistry (0006-2960) 2006 partial coverage rapid curation cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT DIP protein P18031 original sequence version: 141 DIP protein P18031 original sequence version: 191 802377DCD33F41FD cav1-ptpn1 1 PTP-1B 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CAV1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation F2 PTP1B targets the phosphorylated tyrosine 14 homomint mint cav1-ptpn1-1 3 CAV1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component over-expressed over expressed level over-expressed living cell living cell PTP-1B 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Asp181Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:57:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:17:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp181ala' Tue Jun 30 16:11:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp181Ala' range MINT-6764874: original sequence: 181-181 : ILHFHYTTWPDFGVPESPAS phosphorylation phosphorylation reaction phosphorylation F5 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. PTP1B targets the phosphorylated tyrosine 14. This experiment uses phosphates mutants, so called trapping mutants, that still bind to their substrates but are not able to carry the phosphorylation reaction through. Development of "substrate-trapping" mutants to identify physiological substrates of protein tyrosine phosphatases. Flint AJ, Tiganis T, Barford D, Tonks NK. Proc Natl Acad Sci U S A. 1997 Mar 4;94(5):1680-5. homomint mint ptpn1-cav1 2 CAV1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate PTP-1B 5 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F6 homomint mint