MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. J. Virol. (0022-538X) 2005 Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no in vivo in vivo anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no J. Virol. (0022-538X) 2005 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. J. Virol. (0022-538X) 2005 Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no J. Virol. (0022-538X) 2005 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. J. Virol. (0022-538X) 2005 Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no J. Virol. (0022-538X) 2005 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. J. Virol. (0022-538X) 2005 Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no J. Virol. (0022-538X) 2005 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. J. Virol. (0022-538X) 2005 Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins no J. Virol. (0022-538X) 2005 hax1_human HCLS1-associated protein X-1 HAX1 HS1BP1 HS1-associating protein X-1 HS1-binding protein 1 protein protein human Homo sapiens Human MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR DIP protein O00165 original sequence version: 138 87EEF0C46857704B vpr_hv192 Protein Vpr R ORF protein Viral protein R vpr protein protein hv192 Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHGLGQHIYETYGDTWTGVEAIIRILQRLLFVHFRIGCQHSRIGILRQRRARNGASRS mint 1A3844B4A138D877 vpr-hax1 1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1C SHORTLABEL=human MT4 cells homomint mint hax1-vpr 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1487984: original sequence: 71-96 : HFRIGCQHSRIGILRQRRARNGASR Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1487992: original sequence: 118-141 : RLREGQTLRDSMLKYPDSHQPRI Stoichiometry: 1.0 physical association physical association F4B F5B homomint mint vpr-hax1-1 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A homomint mint vpr-hax1-2 4 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F1B homomint mint hax1-vpr-1 5 vpr 7 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1488040: original sequence: 71-96 : HFRIGCQHSRIGILRQRRARNGASR Stoichiometry: 1.0 HAX1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1488049: original sequence: 118-141 : RLREGQTLRDSMLKYPDSHQPRI gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F4A F3 F5A homomint mint