UniProt UniProt http://www.uniprot.org Human immunodeficiency virus type 1 Vpr induces the degradation of the UNG and SMUG uracil-DNA glycosylases. Human immunodeficiency virus type 1 Vpr induces the degradation of the UNG and SMUG uracil-DNA glycosylases. J. Virol. (0022-538X) 2005 imex curation Schröfelbauer B., Yu Q., Zeitlin S.G., Landau N.R. Virus - Publications including interactions involving viral proteins HIV-1 Vpr has been mapped to the UniProt virus reference strain. Experiments involving transfected myc-tagged cullins 1 and 4 not included as origins of the plasmids cannot be established from the article (fig 4B). Landau@salk.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Schröfelbauer B., Yu Q., Zeitlin S.G., Landau N.R. Virus - Publications including interactions involving viral proteins HIV-1 Vpr has been mapped to the UniProt virus reference strain. Experiments involving transfected myc-tagged cullins 1 and 4 not included as origins of the plasmids cannot be established from the article (fig 4B). Landau@salk.edu Accepted 2015-AUG-07 by PPORRAS J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation imex curation Human immunodeficiency virus type 1 Vpr induces the degradation of the UNG and SMUG uracil-DNA glycosylases. Human immunodeficiency virus type 1 Vpr induces the degradation of the UNG and SMUG uracil-DNA glycosylases. J. Virol. (0022-538X) 2005 imex curation Schröfelbauer B., Yu Q., Zeitlin S.G., Landau N.R. Virus - Publications including interactions involving viral proteins HIV-1 Vpr has been mapped to the UniProt virus reference strain. Experiments involving transfected myc-tagged cullins 1 and 4 not included as origins of the plasmids cannot be established from the article (fig 4B). Landau@salk.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Schröfelbauer B., Yu Q., Zeitlin S.G., Landau N.R. Virus - Publications including interactions involving viral proteins HIV-1 Vpr has been mapped to the UniProt virus reference strain. Experiments involving transfected myc-tagged cullins 1 and 4 not included as origins of the plasmids cannot be established from the article (fig 4B). Landau@salk.edu Accepted 2015-AUG-07 by PPORRAS J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation imex curation p13051-1 Uracil-DNA glycosylase UNG2 UNG DGU UNG1 UNG15 protein protein human Homo sapiens Human MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL A4B27E6198AFE9C0 smug1_human Single-strand selective monofunctional uracil DNA glycosylase SMUG1 protein protein human Homo sapiens Human MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLK 2AB18F6F757F6DD7 vpr_hv1h2 Protein Vpr vpr R ORF protein Viral protein R protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASRS 42892A4249E83D3E ung_human Uracil-DNA glycosylase UNG DGU UNG15 UNG1 protein protein human Homo sapiens Human MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL A4B27E6198AFE9C0 ung-vpr-2 1 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A smug1-vpr-1 1 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 4A ung-vpr-1 2 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2