HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Varicelloviruses avoid T cell recognition by UL49.5-mediated inactivation of the transporter associated with antigen processing. Varicelloviruses avoid T cell recognition by UL49.5-mediated inactivation of the transporter associated with antigen processing. Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Koppers-Lalic D., Reits EA., Ressing ME., Lipinska AD., Abele R., Koch J., Marcondes Rezende M., Admiraal P., van Leeuwen D., Bienkowska-Szewczyk K., Mettenleiter TC., Rijsewijk FA., Tampé R., Neefjes J., Wiertz EJ. Virus - Publications including interactions involving viral proteins No entry is available for the GN protein from strain Lam used in this publication so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (aa seq of GN in fig. 1B match with 99% to Q77CE4 ). wiertz@lumc.nl 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mel_juso Homo sapiens mel_juso anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Koppers-Lalic D., Reits EA., Ressing ME., Lipinska AD., Abele R., Koch J., Marcondes Rezende M., Admiraal P., van Leeuwen D., Bienkowska-Szewczyk K., Mettenleiter TC., Rijsewijk FA., Tampé R., Neefjes J., Wiertz EJ. Virus - Publications including interactions involving viral proteins publication also shows interaction between Tap1 and MHC class I heavy chain that was not entered No entry is available for the GN protein from strain Lam used in this publication so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (aa seq of GN in fig. 1B match with 99% to Q77CE4 ). wiertz@lumc.nl Accepted 2015-NOV-26 AT 09:11 GMT AT 09:11 GMT by ORCHARD Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Varicelloviruses avoid T cell recognition by UL49.5-mediated inactivation of the transporter associated with antigen processing. Varicelloviruses avoid T cell recognition by UL49.5-mediated inactivation of the transporter associated with antigen processing. Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Koppers-Lalic D., Reits EA., Ressing ME., Lipinska AD., Abele R., Koch J., Marcondes Rezende M., Admiraal P., van Leeuwen D., Bienkowska-Szewczyk K., Mettenleiter TC., Rijsewijk FA., Tampé R., Neefjes J., Wiertz EJ. Virus - Publications including interactions involving viral proteins No entry is available for the GN protein from strain Lam used in this publication so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (aa seq of GN in fig. 1B match with 99% to Q77CE4 ). wiertz@lumc.nl 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Koppers-Lalic D., Reits EA., Ressing ME., Lipinska AD., Abele R., Koch J., Marcondes Rezende M., Admiraal P., van Leeuwen D., Bienkowska-Szewczyk K., Mettenleiter TC., Rijsewijk FA., Tampé R., Neefjes J., Wiertz EJ. Virus - Publications including interactions involving viral proteins publication also shows interaction between Tap1 and MHC class I heavy chain that was not entered No entry is available for the GN protein from strain Lam used in this publication so the accession Q77CE4 (GN_BHV1C) from cooper strain was used (aa seq of GN in fig. 1B match with 99% to Q77CE4 ). wiertz@lumc.nl Accepted 2015-NOV-26 AT 09:11 GMT AT 09:11 GMT by ORCHARD Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation tpsn_human Tapasin TAP-binding protein TAP-associated protein NGS-17 TAPBP NGS17 TAPA protein protein human Homo sapiens Human MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE 7340549519B288AD gn_bhv1c Envelope glycoprotein N gN UL49.5 protein protein bhv1c Bovine herpesvirus 1.1 (strain Cooper) BoHV-1 Infectious bovine rhinotracheitis virus MPRSPLIVAVVAAALFAIVRGRDPLLDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKESRGRG tap1_human Antigen peptide transporter 1 ABCB2 PSF1 RING4 Y3 TAP1 Peptide transporter TAP1 ATP-binding cassette sub-family B member 2 Peptide supply factor 1 Peptide transporter PSF1 Peptide transporter involved in antigen processing 1 Really interesting new gene 4 protein protein protein human Homo sapiens Human MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE DIP protein Q03518 original sequence version: 123 DIP protein Q03518 original sequence version: 173 9CA5FF96FADD6A1B tap2_human Antigen peptide transporter 2 ATP-binding cassette sub-family B member 3 Peptide transporter TAP2 Peptide supply factor 2 Peptide transporter PSF2 Peptide transporter involved in antigen processing 2 TAP2 ABCB3 PSF2 RING11 Y1 Really interesting new gene 11 protein protein protein human Homo sapiens Human MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL DIP protein Q03519 original sequence version: 123 DIP protein Q03519 original sequence version: 176 E7E4A7F6A2A3B48B tap1-ul49.5-2 1 5 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C tap1-gn_bhv1c_1-3 2 6 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C tapbp-gn_bhv1c_1-1 2 3 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C