MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. FEBS Lett. (0014-5793) 2005 imex curation Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins no 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. FEBS Lett. (0014-5793) 2005 imex curation Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins no 2009-01-08 Only protein-protein interactions in vivo in vivo anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. FEBS Lett. (0014-5793) 2005 imex curation Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins no 2009-01-08 Only protein-protein interactions human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line fluorescence imaging fluorescence microscopy fluorescence imaging monoclonal western monoclonal antibody western blot monoclonal western Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. FEBS Lett. (0014-5793) 2005 imex curation Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins no 2009-01-08 Only protein-protein interactions human-ws Homo sapiens Werner Syndrom (WS) cell line transformed with SV40 (AG11395 cell line) ws Human Werner Syndrome (WS) cell line transformed with SV40 (AG11395 cell line) imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY DIP protein P16104 original sequence version: 114 DIP protein P16104 original sequence version: 110 DIP protein P16104 original sequence version: 117 DIP protein P16104 original sequence version: 133 DIP protein P16104 original sequence version: 140 DIP protein P16104 original sequence version: 113 DIP protein P16104 original sequence version: 99 D4683775C2E6C3A9 wrn_human Werner syndrome ATP-dependent helicase WRN RECQ3 RECQL2 Exonuclease WRN RecQ protein-like 2 DNA helicase, RecQ-like type 3 protein protein human Homo sapiens Human MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRRVSILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGEDVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYKSTEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLENLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSKTVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKAYSSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS DIP protein Q14191 original sequence version: 125 DIP protein Q14191 original sequence version: 175 63F10D19E90AA461 nalp2_human NACHT, LRR and PYD domains-containing protein 2 NLRP2 NALP2 NBS1 PAN1 PYPAF2 Nucleotide-binding site protein 1 PYRIN domain and NACHT domain-containing protein 1 PYRIN-containing APAF1-like protein 2 protein protein human Homo sapiens Human MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRHPECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKCFLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWAERPSSHDFMI DIP protein Q9NX02 original sequence version: 138 4DBB0F6E9C2BC8A7 h2afx-wrn 3 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F1B FEBS-Letters homomint mint wrn-h2afx 3 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F2 SHOTLABEL=NBS cells. The interaction occurs in the insoluble fraction and after 3 hours of gamma-irradiation. The WRN association with H2AX depends upon Nbs1 expression and Nbs1 Ser-343 phosphorylation FEBS-Letters homomint mint h2afx-wrn-1 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association The M/R/N complex enhances the association of WRN with H2Ax F6A F6B homomint mint h2afx-nlrp2 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F6 Treatment with PP1 phosphatase abolish the association of Nbs1 with H2Ax FEBS-Letters homomint mint wrn-h2afx-1 2 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1A SHOTLABEL=MRC-5 cells. The interaction occurs in the soluble fraction and after 3 hours of gamma-irradiation. FEBS-Letters homomint mint wrn-nlrp2 2 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1A SHOTLABEL=MRC-5 cells. The interaction occurs in the insoluble fraction and after 3 hours of gamma-irradiation. FEBS-Letters homomint mint h2afx-wrn-2 4 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F4 BIOSOURCE=NBS cells. The interaction occurs after 3 hours of gamma-irradiation. The WRN association with H2AX depends upon Nbs1 expression and Nbs1 Ser-343 phosphorylation FEBS-Letters homomint mint h2afx-nlrp2-1 4 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F5 BIOSOURCE=MRC-5 cells. The interaction occurs after 6 hours of gamma-irradiation. The co-localization of Nbs1 with H2AX is indipendent of WRN expression FEBS-Letters homomint mint h2afx-nlrp2-2 4 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F5 BIOSOURCE=WS cells. The interaction occurs after 6 hours of gamma-irradiation. The co-localization of Nbs1 with H2AX is indipendent of WRN expression FEBS-Letters homomint mint