MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Protein interactions among the vaccinia virus late transcription factors. Protein interactions among the vaccinia virus late transcription factors. Virology (0042-6822) 2004 rapid curation Dellis S., Strickland KC., McCrary WJ., Patel A., Stocum E., Wright CF. Virus - Publications including interactions involving viral proteins suggested by aceol rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dellis S., Strickland KC., McCrary WJ., Patel A., Stocum E., Wright CF. Virus - Publications including interactions involving viral proteins suggested by aceol Virology (0042-6822) 2004 rapid curation rapid curation Protein interactions among the vaccinia virus late transcription factors. Protein interactions among the vaccinia virus late transcription factors. Virology (0042-6822) 2004 rapid curation Dellis S., Strickland KC., McCrary WJ., Patel A., Stocum E., Wright CF. Virus - Publications including interactions involving viral proteins suggested by aceol rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dellis S., Strickland KC., McCrary WJ., Patel A., Stocum E., Wright CF. Virus - Publications including interactions involving viral proteins suggested by aceol Virology (0042-6822) 2004 rapid curation rapid curation Protein interactions among the vaccinia virus late transcription factors. Protein interactions among the vaccinia virus late transcription factors. Virology (0042-6822) 2004 rapid curation Dellis S., Strickland KC., McCrary WJ., Patel A., Stocum E., Wright CF. Virus - Publications including interactions involving viral proteins suggested by aceol rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dellis S., Strickland KC., McCrary WJ., Patel A., Stocum E., Wright CF. Virus - Publications including interactions involving viral proteins suggested by aceol Virology (0042-6822) 2004 rapid curation rapid curation vltf3_vaccc Viral late gene transcription factor 3 VLTF3 A2L Trans-activator protein A2 protein protein vaccc Vaccinia virus (strain Copenhagen) (VACV) VACV MNLRLCSGCRHNGIVSEQGYEYCIFCESVFQKCTKVQKKSNFHVSNKLIHLRNVLRRLLSHQCSGEIISELLDIMEKNQISTDDVDANFVSSFLKANERINKKDYKLVFEIINQVKDEKLNLSTEKINEVVEIFKHLVFFCQENTPSKTINYSFFLDKIFDITSVTKNLKPQTVKNYTKNNSNQLVWENFLAHMRSKKRVTMVEDYGHEYVFVDERFSTCSLEV mint Acts with RNA polymerase to initiate transcription from late gene promoters B2406504F65885FB rbm3_human RNA-binding protein 3 RBM3 RNPL RNA-binding motif protein 3 protein protein human Homo sapiens Human MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN 91C12E2A3E32CFA4 roa2_human Heterogeneous nuclear ribonucleoproteins A2/B1 HNRNPA2B1 HNRPA2B1 protein protein human Homo sapiens Human MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY DIP protein P22626 original sequence version: 152 DIP protein P22626 original sequence version: 159 4C2560A3D8E99D62 h5_vaccw Late transcription elongation factor H5 Viral late gene transcription factor 4 H5R VACWR103 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MAWSITNKADTSSFTKMAEIRAHLKNSAENKDKNEDIFPEDVIIPSTKPKTKRATTPRKPAATKRSTKKEEVEEEVVIEEYHQTTEKNSPSPGVSDIVESVAAVELDDSDGDDEPMVQVEAGKVNHSARSDLSDLKVATDNIVKDLKKIITRISAVSTVLEDVQAAGISRQFTSMTKAITTLSDLVTEGKSKVVRKKVKTCKK mint 89B54D5DFD976B7D vltf2_vaccw Viral late gene transcription factor 2 VLTF2 VACWR119 A1L Trans-activator protein A1 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MAKRVSLPDVVISAPKAVFKPAKEEALACILPKYYKSMADVSIKTNSVIDKCWFCNQDLVFKPISIETFKGGEVGYFCSKICRDSLASMVKSHVALREEPKISLLPLVFYEDKEKVINTINLLRDKDGVYGSCYFKENSQIIDISLRSLL mint Acts with RNA polymerase to initiate transcription from late gene promoters 5569B1B78F0A9A8D vltf1_vaccw Late transcription factor 1 VLTF1 VACWR086 G8R Trans-activator protein GK1 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFKDDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD mint Acts with RNA polymerase to initiate transcription from late gene promoters D2407C4A5CEF4D69 vltf3-rbm3 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association T1 homomint mint vltf3-vltf1 2 4 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association T1 homomint mint vltf3-h5 2 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association T1 homomint mint h5-vltf1 2 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association T1 homomint mint h5-vltf1-1 3 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association T1 homomint mint vltf1-h5 2 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association T1 homomint mint vltf2-vltf2 2 8 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association T1 homomint mint vltf2-vltf1-1 2 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association T1 homomint mint vltf2-h5 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association T1 homomint mint hnrnpa2b1-hnrnpa2b1 2 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association T1 homomint mint hnrnpa2b1-rbm3 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association T1 homomint mint hnrnpa2b1-h5 2 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association T1 homomint mint vltf2-vltf2-1 1 8 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association F2 homomint mint vltf1-vltf1-1 1 9 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association F2 homomint mint vltf1-vltf2 1 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association F2 homomint mint vltf2-vltf1-2 1 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association F2 homomint mint vltf1-vltf3 1 4 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association F2 homomint mint vltf3-vltf1-1 1 4 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association F2 homomint mint h5-h5 1 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F2 homomint mint h5-vltf3 1 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association F2 homomint mint h5-vltf1-2 1 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F2 homomint mint vltf3-rbm3-1 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association F2 homomint mint vltf3-hnrnpa2b1 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association F2 homomint mint