MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. EMBO J. (0261-4189) 2004 imex curation Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no EMBO J. (0261-4189) 2004 Only protein-protein interactions imex curation Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. EMBO J. (0261-4189) 2004 imex curation Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions in vitro In vitro experimental interac experimental interaction detection experimental interac nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no EMBO J. (0261-4189) 2004 Only protein-protein interactions imex curation Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. EMBO J. (0261-4189) 2004 imex curation Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down predetermined predetermined participant predetermined Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no EMBO J. (0261-4189) 2004 Only protein-protein interactions imex curation Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. EMBO J. (0261-4189) 2004 imex curation Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no EMBO J. (0261-4189) 2004 Only protein-protein interactions imex curation Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. Xrcc4 physically links DNA end processing by polynucleotide kinase to DNA ligation by DNA ligase IV. EMBO J. (0261-4189) 2004 imex curation Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Koch CA., Agyei R., Galicia S., Metalnikov P., O'Donnell P., Starostine A., Weinfeld M., Durocher D. Virus - Publications including interactions involving viral proteins no EMBO J. (0261-4189) 2004 Only protein-protein interactions imex curation xrcc4_human DNA repair protein XRCC4 X-ray repair cross-complementing protein 4 XRCC4 protein protein human Homo sapiens Human MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI DIP protein Q13426 original sequence version: 140 DIP protein Q13426-1 original sequence version: 116 BE5FB99153479A4E csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ DIP protein P68400 original sequence version: 88 DIP protein P68400 original sequence version: 78 DIP protein P68400 original sequence version: 100 DIP protein P68400 original sequence version: 110 DIP protein P68400 original sequence version: 125 DIP protein P68400 original sequence version: 136 D3B6F5D13FF7422D pnkp_human Bifunctional polynucleotide phosphatase/kinase Polynucleotide kinase-3'-phosphatase DNA 5'-kinase/3'-phosphatase PNKP protein protein human Homo sapiens Human MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSGPLCLPESRALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILEIPFRLWVEPRLGRLYCQFSEG 22B5C94D41E62516 pnkp-xrcc4-3 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1205780: original sequence: 227-240 : PVYDESTDEESEN phosphothreonine o-phospho-threonine opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain range MINT-1205782: original sequence: 233-233 : ADRDPVYDESTDEESENQTD Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1205790: original sequence: 1-136 : MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAEL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 association association Experimental=peptide binding assay F3A F3B homomint mint csnk2a1-xrcc4 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1205742: original sequence: 227-240 : PVYDESTDEESEN tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation F5 O-phospho-L-threonine@233 homomint mint pnkp-xrcc4-4 3 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1205766: original sequence: 1-136 : MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAEL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96T60:p.Arg35Ala mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing ' Wed May 02 16:37:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg35ala' Tue Jun 30 18:04:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg35Ala' Stoichiometry: 1.0 physical association physical association F1F homomint mint pnkp-xrcc4-5 5 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 8 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1E homomint mint pnkp-xrcc4-6 1 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1205818: original sequence: 1-250 : MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASA Q13426:p.Thr233Ala mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing ' Wed May 02 14:56:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr233ala' Tue Jun 30 18:23:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr233Ala' Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1205826: original sequence: 1-136 : MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAEL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2 homomint mint pnkp-xrcc4-7 4 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed phosphothreonine o-phospho-threonine opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain range MINT-1205842: original sequence: 233-233 : ADRDPVYDESTDEESENQTD tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1205840: original sequence: 227-240 : PVYDESTDEESEN Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1205850: original sequence: 1-136 : MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAEL Stoichiometry: 1.0 physical association physical association F4A 4.1 picomolar homomint mint