HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. J. Virol. (0022-538X) 2003 imex curation Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp Accepted 2014-JUL-18 by MGT J. Virol. (0022-538X) 2003 imex curation Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. J. Virol. (0022-538X) 2003 imex curation Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp Accepted 2014-JUL-18 by MGT J. Virol. (0022-538X) 2003 imex curation Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. J. Virol. (0022-538X) 2003 imex curation Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp Accepted 2014-JUL-18 by MGT J. Virol. (0022-538X) 2003 imex curation Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. J. Virol. (0022-538X) 2003 imex curation Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp Accepted 2014-JUL-18 by MGT J. Virol. (0022-538X) 2003 imex curation Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. J. Virol. (0022-538X) 2003 imex curation Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins Human fetal brain and liver cDNA matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp Accepted 2014-JUL-18 by MGT J. Virol. (0022-538X) 2003 imex curation Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. J. Virol. (0022-538X) 2003 imex curation Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp Accepted 2014-JUL-18 by MGT J. Virol. (0022-538X) 2003 imex curation Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. J. Virol. (0022-538X) 2003 imex curation Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp Accepted 2014-JUL-18 by MGT J. Virol. (0022-538X) 2003 imex curation Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. J. Virol. (0022-538X) 2003 imex curation Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp Accepted 2014-JUL-18 by MGT J. Virol. (0022-538X) 2003 imex curation o93077_9hepc Core protein precursor Mature core protein NS3 helicase NS3 protease Protease NS2 Serine protease/helicase NS3 Viroporin p7 Viroporin p70 p23 p56/58 Envelope glycoprotein E1 Envelope glycoprotein E2 Genome polyprotein Gp32 Hepacivirin NS1 NS3P NS5B Non-structural protein 4A Non-structural protein 4B Non-structural protein 5A RNA-directed RNA polymerase gp35 gp68 gp70 p21 p27 p68 p8 protein protein 9hepc Hepatitis C virus MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPNDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASAYEVRNVSGIYHVTNDCSNSSIVYEAADVIMHAPGCVPCVRENNSSRCWVALTPTLAARNASVPTTTLRRHVDLLVGTAAFCSAMYVGDLCGSVFLISQLFTFSPRRHETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTAALVVSQLLRIPQAVMDMVAGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGHTRVTGGVQGHVTSTLTSLFRPGASQKIQLVNTNGSWHINRTALNCNDSLKTGFLAALFYTHKFNASGCPERMASCRSIDKFDQGWGPITYAQPDNSDQRPYCWHYAPRQCGIVPASQVCGPVYCFTPSPVVVGTTDRFGAPTYNWGDNETDVLLLNNTRPPHGNWFGCTWMNSTGFTKTCGGPPCNIRGVGNNTLTCPTDCFRKHPDATYTKCGSGPWLTPRCLVDYPYRLWHYPCTVNFTIFKVRMYVGGVEHRLDAACNWTRGERCDLEDRDRAELSPLLLSTTEWQILPCSYTTLPALSTGLIHLHQNIVDIQYLYGIGSAVVSIAIKWEYVVLLFLLLADARVCACLWMMLLIAQAEAALENLVVLNAASVVGAHGMLPFFMFFCAAWYMKGRLVPGAAYAFYGVWPLLLLLLALPPRAYAMDREMVASCGGGVFVGLALLTLSPYCKVFLARLIWWLQYFITKAEAHLQVSLPPLNVRGGRDAIILLMCAVHPELIFDITKLLLSILGPLMVLQASLIRVPYFVRAQGLIRACMLVRKAAGGHYVQMAFVKLAALTGTYVYDHLTPLQDWAHVGLRDLAVAVEPVVFSAMETKVITWGADTAACGDIISGLPVSARRGKEILLGPADSFEGQGWRLLAPITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTAKQSFLATCVNGACWTVFHGAGSKTLAAAKGPITQMYTNVDQDLVGWPAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRSPVFTDNSTPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYMVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTSILGIGTVLDQAETVGARFVVLATATPPGSITFPHPNIEEVPLANTGEIPFYAKTIPIEVIRGGRHLIFCHSKKKCDELPAKLSALGLNAVAYYRGLDVSVIPASGDVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRTQRRGRTGRGRRGIYRFVTPGERPSAMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAKAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTSTWVLVGGVLAALAAYCLTTGSVVIVGRIILSGRPAVIPDREVLYQEFDEMEECASHLPYIEQGMQLAEQFKQKALGLLQTATKQAEAAAPVVESKWRALETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTASITSPLATQYTLLFNILGGWVAAQLAPPSAASAFVGAGIAGAAVGSIGLGKVLVDILAGYGAGVAGALVAFKVMSGDMPSTEDLVNLLPAILSPGALVVGVVCAAILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQILSNLTITQLLKRLHQWINEDCSTPCSGSWLRDVWDWICTVLADFKTWLQSKLLPRLPGVPFFSCQRGYKGVWRGDGIMYTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTELDGVRLHRYAPACKPLLRDEVTFQVGLNQYTVGSQLPCEPEPDVTVVTSMLTDPSHITAEAARRRLARGSPPSLAGSSASQLSALSLKATCTTHHGAPDTDLIEANLLWRQEMGGNITRVESENKIVILDSFEPLRAEEDEREVSAAAEILRKTRKFPAAMPVWARPDYNPPLLESWKNPDYVPPVVHGCPLPPTKAPPIPPPRRKRTVVLTESTVSSALAELATKTFGGSGSSAVDSGTATGPPDQASAEGDAGSDAESYSSMPPLEGEPGDPDLSDGSWSTVSEEASEDVVCCSMSYTWTGALITPCAAEESKLPINALSNPLLRHHNMVYSTTSRSASLRQKKVTFDRMQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSAKSKFGYGAKDVRSLSSRAVNHIRSVWKDLLEDTDTPIQTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPKQRVEFLVNTWKAKKCPMGFSYDTRCFDSTVTENDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPMTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKAAAACRAAKLQDCTMLVCGDDLVVICDSAGTQEDAASLRVFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGATYSIEPLDLPQIIQRLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRVWRHRARSVRAKLLSQGGRAATCGKYLFNWAVKTKLKLTPIPEASQLDLSGWFVAGYSGGDIYHSLSRARPRWFMWCLLLLSVGVGIYLLPNR 888BBA102A733390 psme3_human Proteasome activator complex subunit 3 PSME3 Proteasome activator 28 subunit gamma Activator of multicatalytic protease subunit 3 11S regulator complex subunit gamma Ki nuclear autoantigen protein protein human Homo sapiens Human MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY 116FAB47D60A26C0 psme3_mouse Proteasome activator complex subunit 3 Psme3 11S regulator complex subunit gamma Activator of multicatalytic protease subunit 3 Ki nuclear autoantigen Proteasome activator 28 subunit gamma protein protein mouse Mus musculus Mouse MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY 116FAB47D60A26C0 core-pa28delta-5 5 10 unspecified role unspecified role prey prey Core 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association No figure core-pa28delta-1 1 10 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Core 9 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2A core-pa28delta-2 8 10 unspecified role unspecified role prey prey Core 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B core-pa28delta-3 8 9 unspecified role unspecified role bait bait n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association 4, 6A and 9 core-pa28delta-4 2 9 unspecified role unspecified role bait bait core_region sufficient to bind sufficient binding region sufficient to bind range range range range 11 unspecified role unspecified role prey prey physical association physical association 2C psme3-o93077-2 7 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 3 o93077-psme3-1 7 9 unspecified role unspecified role neutral component neutral component n terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role neutral component neutral component rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 5A core-pa28delta-7 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C core-pa28delta-8 8 9 unspecified role unspecified role bait bait n terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association 6C core-pa28delta-9 3 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6A psme3-o93077-1 7 10 unspecified role unspecified role neutral component neutral component rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined regions mutation mutation range range range range range range range range Wed Jul 06 15:02:23 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was delta-nls-mutation 9 unspecified role unspecified role neutral component neutral component n terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization 5A core-psme3-1 6 9 unspecified role unspecified role bait bait core_region sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role prey prey physical association physical association 2D