HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. Int. J. Cancer (0020-7136) 2003 imex curation Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw Accepted 2014-MAY-14 by MGT Int. J. Cancer (0020-7136) 2003 Only protein-protein interactions imex curation Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. Int. J. Cancer (0020-7136) 2003 imex curation Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw Accepted 2014-MAY-14 by MGT Int. J. Cancer (0020-7136) 2003 Only protein-protein interactions imex curation Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. Int. J. Cancer (0020-7136) 2003 imex curation Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw Accepted 2014-MAY-14 by MGT Int. J. Cancer (0020-7136) 2003 Only protein-protein interactions imex curation p26662-pro_0000037647 Non-structural protein 5A protein protein hcvja Hepatitis C virus genotype 1b (isolate Japanese) SGSWLKDVWDWICTVLSDFKTWLQSKLLPRLPGLPFLSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPKTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPVCKPLLREEVVFQVGLNQYLVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSAPSLKATCTTHHDSPDADLIEANLLWRQEMGGNITRVESENKVVILDSFDPIRAVEDEREISVPAEILRKPRKFPPALPIWARPDYNPPLLESWKDPDYVPPVVHGCPLPSTKAPPIPPPRRKRTVVLTESTVSSALAELATKTFGSSGSSAVDSGTATGPPDQASDDGDKGSDVESYSSMPPLEGEPGDPDLSDGSWSTVSGEAGEDVVCC 1973 2419 732B643F11C6EE8B bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 ns5a-bax 1 4 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait physical association physical association 4D Interaction happens in response to stimulation with sodium phenylbutyrate (NaPB), a butyrate analogue, histone deacetylase inhibitor and inducer of apoptosis. ns5a-bax-1 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range bh2_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4D and 6B Interaction happens in response to stimulation with sodium phenylbutyrate (NaPB), a butyrate analogue and histone deacetylase inhibitor. ns5a-bax-2 3 4 unspecified role unspecified role bait bait bh2_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). physical association physical association 6A Interaction happens in response to stimulation with sodium phenylbutyrate (NaPB), a butyrate analogue and histone deacetylase inhibitor.