MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of 14-3-3 with Bid during seizure-induced neuronal death. Interaction of 14-3-3 with Bid during seizure-induced neuronal death. J. Neurochem. (0022-3042) 2003 Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no J. Neurochem. (0022-3042) 2003 Interaction of 14-3-3 with Bid during seizure-induced neuronal death. Interaction of 14-3-3 with Bid during seizure-induced neuronal death. J. Neurochem. (0022-3042) 2003 Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no J. Neurochem. (0022-3042) 2003 Interaction of 14-3-3 with Bid during seizure-induced neuronal death. Interaction of 14-3-3 with Bid during seizure-induced neuronal death. J. Neurochem. (0022-3042) 2003 Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no J. Neurochem. (0022-3042) 2003 Interaction of 14-3-3 with Bid during seizure-induced neuronal death. Interaction of 14-3-3 with Bid during seizure-induced neuronal death. J. Neurochem. (0022-3042) 2003 Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no in vivo in vivo anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no J. Neurochem. (0022-3042) 2003 Interaction of 14-3-3 with Bid during seizure-induced neuronal death. Interaction of 14-3-3 with Bid during seizure-induced neuronal death. J. Neurochem. (0022-3042) 2003 Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no J. Neurochem. (0022-3042) 2003 Interaction of 14-3-3 with Bid during seizure-induced neuronal death. Interaction of 14-3-3 with Bid during seizure-induced neuronal death. J. Neurochem. (0022-3042) 2003 Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Shinoda S., Schindler CK., Quan-Lan J., Saugstad JA., Taki W., Simon RP., Henshall DC. Virus - Publications including interactions involving viral proteins no J. Neurochem. (0022-3042) 2003 mpip2_human M-phase inducer phosphatase 2 Dual specificity phosphatase Cdc25B CDC25B CDC25HU2 protein protein human Homo sapiens Human MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPDRKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ EDE24B0E84AC1BE3 bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 bid_rat BH3-interacting domain death agonist p22 BID Bid protein protein rat Rattus norvegicus (Rat) Rat MDSEVSNGSGLGAEHITNLLVFGFLRNNDRDFHQELEVLGQELPVQVYLEGDREDELQTDGSRASRSFYHGRIEPDSESQDEVIHNIARHLAQAGDELDHSIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTSFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFRTTVNFINQNLFSYVRDLVRNEMD C5F6AD2F5D9B52E3 1433b_rat 14-3-3 protein beta/alpha Protein kinase C inhibitor protein 1 Prepronerve growth factor RNH-1 Ywhab protein protein rat Rattus norvegicus (Rat) Rat MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICSDVLELLDKYLILNATHAESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN B663D1F2182F9C43 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 ywhab-cdc25b 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint ywhae-cdc25b 1 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 physical association physical association homomint mint ywhab-bid 5 12 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint bid-ywhab 2 11 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 10 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint bid-ywhab-1 3 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint bid-ywhab-2 4 12 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint bid-ywhab-3 6 10 unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 11 unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization homomint mint