MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Tyrosine phosphorylation of the CrkII adaptor protein modulates cell migration. Tyrosine phosphorylation of the CrkII adaptor protein modulates cell migration. J. Cell. Sci. (0021-9533) 2003 Takino T., Tamura M., Miyamori H., Araki M., Matsumoto K., Sato H., Yamada KM. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B partial coverage rapid curation human-293 ebna Homo sapiens 293 ebna 293 ebna phosphatase assay phosphatase assay western blot western blot Immuno blot Immuno blot Takino T., Tamura M., Miyamori H., Araki M., Matsumoto K., Sato H., Yamada KM. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B PTP1B J. Cell. Sci. (0021-9533) 2003 partial coverage rapid curation Tyrosine phosphorylation of the CrkII adaptor protein modulates cell migration. Tyrosine phosphorylation of the CrkII adaptor protein modulates cell migration. J. Cell. Sci. (0021-9533) 2003 Takino T., Tamura M., Miyamori H., Araki M., Matsumoto K., Sato H., Yamada KM. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B partial coverage rapid curation human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Takino T., Tamura M., Miyamori H., Araki M., Matsumoto K., Sato H., Yamada KM. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B PTP1B J. Cell. Sci. (0021-9533) 2003 partial coverage rapid curation Tyrosine phosphorylation of the CrkII adaptor protein modulates cell migration. Tyrosine phosphorylation of the CrkII adaptor protein modulates cell migration. J. Cell. Sci. (0021-9533) 2003 Takino T., Tamura M., Miyamori H., Araki M., Matsumoto K., Sato H., Yamada KM. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B partial coverage rapid curation human-293 ebna Homo sapiens 293 ebna 293 ebna anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Takino T., Tamura M., Miyamori H., Araki M., Matsumoto K., Sato H., Yamada KM. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B PTP1B J. Cell. Sci. (0021-9533) 2003 partial coverage rapid curation bcar1_human Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas BCAR1 CAS CRKAS CASS1 Cas scaffolding protein family member 1 protein protein human Homo sapiens Human MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA DIP protein P56945 original sequence version: 113 DIP protein P56945 original sequence version: 116 B81EC3430049E795 ptn1_chick Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B CPTP1 protein protein chick Gallus gallus (Chicken) Chicken MEIEKEFHRLDQAASWAAIYQDIRHEASDFPCKVAKHPRNKNRNRYRDVSPFDHSRIKLNQGDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSIKCAQYWPRKEEKEMFFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEYGPVVVHCSAGIGRSGTFCLVDTCLLLMDKRKDPSSVDVKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAKFIMGDASVQEQWKELSNEDLDPPPEHTPPPPRPPKRTSEMHNGRMHEHAEFFPKHQVVEEEIRCSVSTAEETVSDGRVFSSVPLITDSTSQDTEIRRRTVGENLHVTAHKEESKSESVEEDDENMMTTWKPFLVNICMFTFLTAGAYLCYRVCFH May play an important role in CKII- and p60c-src-induced signal transduction cascades mint homomint 0FF340B2333CC311 crk_human Adapter molecule crk Proto-oncogene c-Crk CRK p38 protein protein human Homo sapiens Human MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS 4CFBFB65BFC2E265 paxi_human Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC DIP protein P49023 original sequence version: 115 DIP protein P49023 original sequence version: 126 DIP protein P49023 original sequence version: 169 DIP protein P49023 original sequence version: 140 DIP protein P49023 original sequence version: 175 ABF6C0BE5939623F bcar1-ptpn1 1 PTP-1B 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p130cas 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level dephosphorylation dephosphorylation reaction dephosphorylation F1 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. Dephosphorylation does not occur in cell overexpressing of CRKII.The phosphatase overexpression cause the dephosphorylation of predicted substrate. homomint domino mint ptpn1-pxn 1 PTP-1B 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Paxillin 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level dephosphorylation dephosphorylation reaction dephosphorylation F1 The phosphatase overexpression cause the dephosphorylation of predicted substrate. No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. homomint domino mint crk-ptpn1 1 PTP-1B 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O13016:p.Cys215Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Tue Jul 12 10:57:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:47:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys215ser' Tue Jun 30 17:52:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys215Ser' range MINT-6763920: original sequence: 215-215 : NPEYGPVVVHCSAGIGRSGT binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CRK 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P46108:p.Tyr221Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:57:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:34:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr221phe' Tue Jun 30 20:25:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr221Phe' range MINT-6763912: original sequence: 221-221 : QPLGGPEPGPYAQPSVNTPL dephosphorylation dephosphorylation reaction dephosphorylation The phosphatase overexpression cause the dephosphorylation of predicted substrate. F2B-C No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. This experiment uses phosphates mutants, so called trapping mutants, that still bind to their substrates but are not able to carry the phosphorylation reaction through. Development of "substrate-trapping" mutants to identify physiological substrates of protein tyrosine phosphatases. Flint AJ, Tiganis T, Barford D, Tonks NK. Proc Natl Acad Sci U S A. 1997 Mar 4;94(5):1680-5. homomint domino mint pxn-crk 3 CRK 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P46108:p.Tyr221Phe mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:23:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:03:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr221phe' Tue Jun 30 19:15:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr221Phe' range MINT-6763932: original sequence: 221-221 : QPLGGPEPGPYAQPSVNTPL Paxillin 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2D homomint mint bcar1-crk-1 3 CRK 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P46108:p.Tyr221Phe mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:23:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:54:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr221phe' Tue Jun 30 18:46:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr221Phe' range MINT-6763940: original sequence: 221-221 : QPLGGPEPGPYAQPSVNTPL p130cas 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2D homomint mint crk-ptpn1-1 2 PTP-1B 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CRK 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F5 homomint mint ptpn1-pxn-1 2 PTP-1B 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Paxillin 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F5 homomint mint