HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. J. Gen. Virol. (0022-1317) 2003 imex curation Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com Accepted 2013-NOV-28 by ORCHARD J. Gen. Virol. (0022-1317) 2003 imex curation Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. J. Gen. Virol. (0022-1317) 2003 imex curation Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com Accepted 2013-NOV-28 by ORCHARD J. Gen. Virol. (0022-1317) 2003 imex curation Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. J. Gen. Virol. (0022-1317) 2003 imex curation Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com Accepted 2013-NOV-28 by ORCHARD J. Gen. Virol. (0022-1317) 2003 imex curation Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. J. Gen. Virol. (0022-1317) 2003 imex curation Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com Accepted 2013-NOV-28 by ORCHARD J. Gen. Virol. (0022-1317) 2003 imex curation Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. J. Gen. Virol. (0022-1317) 2003 imex curation Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com Accepted 2013-NOV-28 by ORCHARD J. Gen. Virol. (0022-1317) 2003 imex curation o00499-6 Myc box-dependent-interacting protein 1 BIN1 AMPHL Amphiphysin II Amphiphysin-like protein Box-dependent myc-interacting protein 1 Bridging integrator 1 protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP DF00A44348B6F1BF bin1_human Myc box-dependent-interacting protein 1 Bridging integrator 1 Amphiphysin-like protein Box-dependent myc-interacting protein 1 BIN1 AMPHL Amphiphysin II protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP 0FF1956F0C7E3B50 p27958-pro_0000037576 Non-structural protein 5A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSMASSSASQLSAPSLKATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREVSVPAEILRKSRRFAPALPVWARPDYNPLLVETWKKPDYEPPVVHGCPLPPPRSPPVPPPRKKRTVVLTESTLPTALAELATKSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDVESYSSMPPLEGEPGDPDLSDGSWSTVSSGADTEDVVCC 1973 2420 106ED331CF52DACA o00499-7 Myc box-dependent-interacting protein 1 BIN1 AMPHL Amphiphysin II Amphiphysin-like protein Box-dependent myc-interacting protein 1 Bridging integrator 1 protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP 350E429F13AF49C6 ns5a-amphiphysin2-3 4 7 unspecified role unspecified role prey prey 33p 33p radiolabel 33p radiolabel P33 33P certain certain sequence position certain certain certain sequence position certain human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma NS5A 8 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1a ns5a-amphiphysin2-1 3 NS5A 8 unspecified role unspecified role bait bait P27958-PRO_0000037576:p.Pro350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:22:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro350ala' Tue Jun 30 16:31:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro350Ala' P27958-PRO_0000037576:p.Pro353Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 19:26:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro353ala' Tue Jun 30 15:34:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro353Ala' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P27958-PRO_0000037576:p.Pro354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:44:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro354ala' Tue Jun 30 18:46:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro354Ala' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma physical association physical association Fig. 1b p27958_pro-bin1-1 2 NS5A 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 2a bin1-p27958_pro-1 1 7 unspecified role unspecified role neutral component neutral component fitc fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 8 unspecified role unspecified role neutral component neutral component cy3 label cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 2b ns5a-amphiphysin2_sh3-1 5 9 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma 7 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma NS5A 8 unspecified role unspecified role bait bait P27958-PRO_0000037576:p.Pro350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:12:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro350ala' Tue Jun 30 19:54:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro350Ala' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P27958-PRO_0000037576:p.Pro353Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:06:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro353ala' Tue Jun 30 18:21:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro353Ala' P27958-PRO_0000037576:p.Pro354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:03:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro354ala' Tue Jun 30 20:11:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro354Ala' ecoli Escherichia coli (strain K12) physical association physical association Fig. 1c ns5a-amphiphysin2-2_short-1 5 9 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma NS5A 8 unspecified role unspecified role bait bait P27958-PRO_0000037576:p.Pro353Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:12:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro353ala' Tue Jun 30 20:15:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro353Ala' P27958-PRO_0000037576:p.Pro354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:12:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro354ala' Tue Jun 30 16:06:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro354Ala' P27958-PRO_0000037576:p.Pro350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:37:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro350ala' Tue Jun 30 18:20:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro350Ala' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1c ns5a-amphiphysin2-2 5 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma NS5A 8 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P27958-PRO_0000037576:p.Pro353Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:36:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro353ala' Tue Jun 30 16:01:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro353Ala' P27958-PRO_0000037576:p.Pro350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 20:21:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro350ala' Tue Jun 30 19:52:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro350Ala' P27958-PRO_0000037576:p.Pro354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:14:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro354ala' Tue Jun 30 16:51:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro354Ala' ecoli Escherichia coli (strain K12) physical association physical association Fig. 1c