MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s). 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s). Cancer Res. (0008-5472) 2002 Liu MY., Cai S., Espejo A., Bedford MT., Walker CL. Virus - Publications including interactions involving viral proteins no partial coverage rapid curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Liu MY., Cai S., Espejo A., Bedford MT., Walker CL. Virus - Publications including interactions involving viral proteins no Cancer Res. (0008-5472) 2002 partial coverage rapid curation 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s). 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s). Cancer Res. (0008-5472) 2002 Liu MY., Cai S., Espejo A., Bedford MT., Walker CL. Virus - Publications including interactions involving viral proteins no partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Liu MY., Cai S., Espejo A., Bedford MT., Walker CL. Virus - Publications including interactions involving viral proteins no Cancer Res. (0008-5472) 2002 partial coverage rapid curation 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s). 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s). Cancer Res. (0008-5472) 2002 Liu MY., Cai S., Espejo A., Bedford MT., Walker CL. Virus - Publications including interactions involving viral proteins no partial coverage rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Liu MY., Cai S., Espejo A., Bedford MT., Walker CL. Virus - Publications including interactions involving viral proteins no Cancer Res. (0008-5472) 2002 partial coverage rapid curation 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s). 14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s). Cancer Res. (0008-5472) 2002 Liu MY., Cai S., Espejo A., Bedford MT., Walker CL. Virus - Publications including interactions involving viral proteins no partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Liu MY., Cai S., Espejo A., Bedford MT., Walker CL. Virus - Publications including interactions involving viral proteins no Cancer Res. (0008-5472) 2002 partial coverage rapid curation 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN DIP protein P61981 original sequence version: 126 DIP protein P61981 original sequence version: 135 B0D16C6DE1F4455D 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 1433s_human 14-3-3 protein sigma Stratifin Epithelial cell marker protein 1 HME1 SFN protein protein human Homo sapiens Human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS DIP protein P31947 original sequence version: 84 7F4B44E3AA59ECE6 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 tsc2_human Tuberin TSC2 Tuberous sclerosis 2 protein TSC4 protein protein human Homo sapiens Human MAKPTSKDSGLKEKFKILLGLGTPRPNPRSAEGKQTEFIITAEILRELSMECGLNNRIRMIGQICEVAKTKKFEEHAVEALWKAVADLLQPERPLEARHAVLALLKAIVQGQGERLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELADFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIARMVQMICLLCVRTASSVDIEVSLQVLDAVVCYNCLPAESLPLFIVTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCHLMEDRAYMEDAPLLRGAVFFVGMALWGAHRLYSLRNSPTSVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQERYFELVERCADQRPESSLLNLISYRAQSIHPAKDGWIQNLQALMERFFRSESRGAVRIKVLDVLSFVLLINRQFYEEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLSPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKKTSGPLSPPTGPPGPAPAGPAVRLGSVPYSLLFRVLLQCLKQESDWKVLKLVLGRLPESLRYKVLIFTSPCSVDQLCSALCSMLSGPKTLERLRGAPEGFSRTDLHLAVVPVLTALISYHNYLDKTKQREMVYCLEQGLIHRCASQCVVALSICSVEMPDIIIKALPVLVVKLTHISATASMAVPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNSPPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADDSLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGELQSGPESSSSPGVHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGALDVPASQFLGSATSPGPRTAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAASTAKPPPLPRSNTVASFSSLYQSSCQGQLHRSVSWADSAVVMEEGSPGEVPVLVEPPGLEDVEAALGMDRRTDAYSRSSSVSSQEEKSLHAEELVGRGIPIERVVSSEGGRPSVDLSFQPSQPLSKSSSSPELQTLQDILGDPGDKADVGRLSPEVKARSQSGTLDGESAAWSASGEDSRGQPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSFVFLQLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIVTPLDYECNLVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV 7B915C46970D7D31 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 ywhaz-tsc2-2 4 TSC2 11 unspecified role unspecified role prey prey purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-723022: original sequence: 939-939 : EKDSFRARSTSLNERPKSLR Stoichiometry: 1.0 1433Z 7 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction Filter binding is, in this paper, a protein domain microarray where the 14-3-3 is on glass and the Cys-5 labeled tuberin phosphopeptidepeptide is overlaid (biotin-SGSGFRARSTpSLNERPK). homomint domino mint ywhag-tsc2 4 1433G 6 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 TSC2 11 unspecified role unspecified role prey prey purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-723046: original sequence: 939-939 : EKDSFRARSTSLNERPKSLR Stoichiometry: 1.0 direct interaction direct interaction homomint domino mint sfn-tsc2 4 1433S 8 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 TSC2 11 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction rnTuberin is presumed to be phosphorylated because the GST pull down is performed with serum-stimulated NIH3T3rn homomint domino mint ywhaq-tsc2-1 4 TSC2 11 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 1433T 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction rnTuberin is presumed to be phosphorylated because the GST pull down is performed with serum-stimulated NIH3T3rn homomint domino mint ywhae-tsc2 4 TSC2 11 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 1433E 9 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction Tuberin is presumed to be phosphorylated because the GST pull down is performed with lysates of serum-stimulated NIH3T3 cell (Tuberin is probably phosphorylated at least by Akt) homomint domino mint ywhab-tsc2-2 4 TSC2 11 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 1433B 12 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction Tuberin is presumed to be phosphorylated because the GST pull down is performed in serum-stimulated NIH3T3 homomint domino mint ywhah-tsc2 4 1433F 10 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 TSC2 11 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction Tuberin is presumed to be phosphorylated because the GST pull down is performed with serum-stimulated NIH3T3 homomint domino mint ywhaz-tsc2-3 1 1433Z 7 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 TSC2 11 unspecified role unspecified role prey prey purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-723035: original sequence: 939-939 : EKDSFRARSTSLNERPKSLR Stoichiometry: 1.0 direct interaction direct interaction Filter binding is, in this paper, a protein domain microarray where the 14-3-3 is on glass and the Cys-5 labeled tuberin phosphopeptidepeptide is overlaid (biotin-SGSGFRARSTpSLNERPK). homomint domino mint ywhag-tsc2-1 1 TSC2 11 unspecified role unspecified role prey prey purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-723056: original sequence: 939-939 : EKDSFRARSTSLNERPKSLR Stoichiometry: 1.0 1433G 6 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint domino mint ywhag-tsc2-2 2 1433G 6 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 TSC2 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-723113: original sequence: 939-939 : EKDSFRARSTSLNERPKSLR Stoichiometry: 1.0 physical association physical association homomint domino mint tsc2-ywhag-1 3 1433G_HUMAN 6 unspecified role unspecified role unspecified role unspecified role TSC2_HUMAN 11 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint