MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. Nature (0028-0836) 2002 Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins no in vivo in vivo experimental interac experimental interaction detection experimental interac nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins no Nature (0028-0836) 2002 Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. Nature (0028-0836) 2002 Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins no Nature (0028-0836) 2002 Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. Nature (0028-0836) 2002 Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins no chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins no Nature (0028-0836) 2002 ub2l6_human Ubiquitin/ISG15-conjugating enzyme E2 L6 UBE2L6 UBCH8 Ubiquitin-protein ligase L6 Ubiquitin carrier protein L6 UbcH8 Retinoic acid-induced gene B protein E2 ubiquitin-conjugating enzyme L6 protein protein human Homo sapiens Human MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS DIP protein O14933 original sequence version: 136 D79768775344EFAE tri25_mouse E3 ubiquitin/ISG15 ligase TRIM25 RING-type E3 ubiquitin transferase TRIM25 Trim25 Efp Zfp147 Znf147 Zinc finger protein 147 Estrogen-responsive finger protein Ubiquitin/ISG15-conjugating enzyme TRIM25 Tripartite motif-containing protein 25 RING-type E3 ubiquitin transferase protein protein mouse Mus musculus Mouse MAELNPLAEELSCSVCLELFKEPVTTPCGHNFCMSCLDETWVVQGPPYRCPQCRKVYQVRPQLQKNTVMCAVVEQFLQAEQARTPVDDWTPPARFSASSAATQVACDHCLTEIAVKTCLVCMASFCQEHLRPHFDSPAFQDHPLQSPIRDLLRRKCTQHNRLRELFCPEHGECICHICLVEHKTCSPTTLSQASADLEYKLRNKLTIMHSHINGATKALEDVRSKQQCVQDSMKRKMEQLRQEYMEMKAVIDAAETSSLRKLKEEEKRVYGKFDTIYQVLVKKKSEMQKLKAEVELIMDKGDEFEFLEKAAKLQGESTKPVYIPKIDLDHDLIMGIYQGAADLKSELKHSIKKLQKKSEEHNGSGNKGDQTQSTFKPVQPSKKTIQEKKTKKTPVAPGPPSHFSPNKLPTFGAPGQSLDSKATSPDAAPKASAAQPDSVGVKAKVLENFLTKSRTELLEYFVKVIFDYNTAHNKVSLSNKYTTASVSDGLQHYRSHPQRFTYCSQVLGLHCYKNGIHYWEVELQKNNFCGVGICYGSMERQGPESRLGRNPNSWCVEWFNNKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVTEKVHLMYKFKVDFTEALYPAFWVFSAGTTLSICSK mint Mediates estrogen action in various target organs 3B764531AAE8582E 1433s_mouse 14-3-3 protein sigma Sfn Mkrn3 Stratifin protein protein mouse Mus musculus Mouse MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS C1C40905824B3F48 trim25-sfn 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined COILED COIL REGION range MINT-717157: original sequence: 81-450 : QARTPVDDWTPPARFSASSAATQVACDHCLTEIAVKTCLVCMASFCQEHLRPHFDSPAFQDHPLQSPIRDLLRRKCTQHNRLREFFCPEHGECICHICLVEHKTCSPTTLSQASADLEYKLRNKLTIMHSHINGATKALEDVRSKQQCVQDSMKRKMEQLRQEYMEMKAVIDAAETSSLRRLKEEEKRVYGKFDTIYQVLVKKKSEMQKLKAEVELIMDKGDEFEFLEKAAKLQGESTKPVYIPKIDLDHDLIMGIYQGAADLKSELKHSIKKLQKKSEEHNGSGNKGDQTQSTFKPVQPSKKTIQEKKTKKTPVAPGPPSHFSPNKLPTFGAPGQSLDSKATSPDAAPKASAAQPDSIGVKAKVLENF [EBI-8480487]The shifted ranges (81-450) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-8480487]81-450 [EBI-8480487]Q61510,1 Stoichiometry: 1.0 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint domino mint trim25-ube2l6 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-717132: original sequence: 1-122 : MAELNPLAEELSCSVCLELFKEPVTTPCGHNFCTSCLDETWVVQGPPYRCPQCRKVYQVRPQLQKNTVMCAVVEQFLQAEQARTPVDDWTPPARFSASSAATQVACDHCLTEIAVKTCLVC [EBI-8480507]The shifted ranges (1-122) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-8480507]1-122 [EBI-8480507]Q61510,1 Stoichiometry: 1.0 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint domino mint sfn-trim25 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 ubiquitination ubiquitination reaction ubiquitination homomint domino mint sfn-trim25-1 3 Efp 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined COILED COIL REGION Stoichiometry: 1.0 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F3A homomint domino mint