UniProt UniProt http://www.uniprot.org Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. J. Virol. (0022-538X) 2002 imex curation Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Murine A92L cells infected with MVM; cell extract 30h postinfection was used. Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu Accepted 2014-MAY-09 by ORCHARD J. Virol. (0022-538X) 2002 imex curation Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. J. Virol. (0022-538X) 2002 imex curation Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-a92l Mus musculus A92L fibroblast cell line a9l2 A9L2 fibroblast cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu Accepted 2014-MAY-09 by ORCHARD J. Virol. (0022-538X) 2002 imex curation Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. J. Virol. (0022-538X) 2002 imex curation Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu Accepted 2014-MAY-09 by ORCHARD J. Virol. (0022-538X) 2002 imex curation Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. Minute virus of mice NS1 interacts with the SMN protein, and they colocalize in novel nuclear bodies induced by parvovirus infection. J. Virol. (0022-538X) 2002 imex curation Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-a92l Mus musculus A92L fibroblast cell line a9l2 A9L2 fibroblast cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young P.J., Jensen K.T., Burger L.R., Pintel D.J., Lorson C.L. Virus - Publications including interactions involving viral proteins Viral proteins have been mapped to the UniProt MVM reference proteome strain. clorson@asu.edu Accepted 2014-MAY-09 by ORCHARD J. Virol. (0022-538X) 2002 imex curation smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B smn_mouse Survival motor neuron protein Smn1 Smn protein protein mouse Mus musculus Mouse MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN 757B3074649F7458 ns1_mumip Initiator protein NS1 NS1 NCVP1 Non-capsid protein NS-1 Non-structural protein NS1 protein protein mumip Murine minute virus (strain MVM prototype) MAGNAYSDEVLGATNWLKEKSNQEVFSFVFKNENVQLNGKDIGWNSYKKELQEDELKSLQRGAETTWDQSEDMEWETTVDEMTKKQVFIFDSLVKKCLFEVLNTKNIFPGDVNWFVQHEWGKDQGWHCHVLIGGKDFSQAQGKWWRRQLNVYWSRWLVTACNVQLTPAERIKLREIAEDNEWVTLLTYKHKQTKKDYTKCVLFGNMIAYYFLTKKKISTSPPRDGGYFLSSDSGWKTNFLKEGERHLVSKLYTDDMRPETVETTVTTAQETKRGRIQTKKEVSIKTTLKELVHKRVTSPEDWMMMQPDSYIEMMAQPGGENLLKNTLEICTLTLARTKTAFDLILEKAETSKLTNFSLPDTRTCRIFAFHGWNYVKVCHAICCVLNRQGGKRNTVLFHGPASTGKSIIAQAIAQAVGNVGCYNAANVNFPFNDCTNKNLIWVEEAGNFGQQVNQFKAICSGQTIRIDQKGKGSKQIEPTPVIMTTNENITVVRIGCEERPEHTQPIRDRMLNIHLTHTLPGDFGLVDKNEWPMICAWLVKNGYQSTMASYCAKWGKVPDWSENWAEPKVPTPINLLGSARSPFTTPKSTPLSQNYALTPLASDLEDLALEPWSTPNTPVAGTAETQNTGEAGSKACQDGQLSPTWSEIEEDLRACFGAEPLKKDFSEPLNLD 50298F27662E3C1D 50298F27662E3C1D ns1-smn1 3 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A smn1-ns1 4 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait physical association physical association 1B smn1-ns1-1 2 7 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 2 upper smn1-ns1-3 1 6 unspecified role unspecified role bait bait mouse-a92l Mus musculus A92L fibroblast cell line a9l2 A9L2 fibroblast cell line 7 unspecified role unspecified role prey prey mouse-a92l Mus musculus A92L fibroblast cell line a9l2 A9L2 fibroblast cell line physical association physical association 1C