MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The DEXD/H-box RNA helicase RHII/Gu is a co-factor for c-Jun-activated transcription. The DEXD/H-box RNA helicase RHII/Gu is a co-factor for c-Jun-activated transcription. EMBO J. (0261-4189) 2002 Westermarck J., Weiss C., Saffrich R., Kast J., Musti AM., Wessely M., Ansorge W., Séraphin B., Wilm M., Valdez BC., Bohmann D. Virus - Publications including interactions involving viral proteins no in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Westermarck J., Weiss C., Saffrich R., Kast J., Musti AM., Wessely M., Ansorge W., Séraphin B., Wilm M., Valdez BC., Bohmann D. Virus - Publications including interactions involving viral proteins no EMBO J. (0261-4189) 2002 The DEXD/H-box RNA helicase RHII/Gu is a co-factor for c-Jun-activated transcription. The DEXD/H-box RNA helicase RHII/Gu is a co-factor for c-Jun-activated transcription. EMBO J. (0261-4189) 2002 Westermarck J., Weiss C., Saffrich R., Kast J., Musti AM., Wessely M., Ansorge W., Séraphin B., Wilm M., Valdez BC., Bohmann D. Virus - Publications including interactions involving viral proteins no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Westermarck J., Weiss C., Saffrich R., Kast J., Musti AM., Wessely M., Ansorge W., Séraphin B., Wilm M., Valdez BC., Bohmann D. Virus - Publications including interactions involving viral proteins no EMBO J. (0261-4189) 2002 The DEXD/H-box RNA helicase RHII/Gu is a co-factor for c-Jun-activated transcription. The DEXD/H-box RNA helicase RHII/Gu is a co-factor for c-Jun-activated transcription. EMBO J. (0261-4189) 2002 Westermarck J., Weiss C., Saffrich R., Kast J., Musti AM., Wessely M., Ansorge W., Séraphin B., Wilm M., Valdez BC., Bohmann D. Virus - Publications including interactions involving viral proteins no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Westermarck J., Weiss C., Saffrich R., Kast J., Musti AM., Wessely M., Ansorge W., Séraphin B., Wilm M., Valdez BC., Bohmann D. Virus - Publications including interactions involving viral proteins no EMBO J. (0261-4189) 2002 ddx21_human Nucleolar RNA helicase 2 DDX21 Nucleolar RNA helicase II Nucleolar RNA helicase Gu RH II/Gu Gu-alpha DEAD box protein 21 protein protein human Homo sapiens Human MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIPVEQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ DIP protein Q9NR30 original sequence version: 160 4F6673E38686644F jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 ddx21-jun 3 DDX21 4 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 AP1 5 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction other techniques = Tandem Affinity Purification method homomint mint ddx21-jun-1 2 DDX21 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 AP1 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association other techniques = Tandem Affinity Purification method homomint mint ddx21-jun-2 1 AP1 5 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 DDX21 4 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association other techniques = Tandem Affinity Purification method homomint mint