HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The bovine herpesvirus 1 immediate-early protein (bICP0) associates with histone deacetylase 1 to activate transcription. The bovine herpesvirus 1 immediate-early protein (bICP0) associates with histone deacetylase 1 to activate transcription. Journal of virology 2001 imex curation Zhang Y., Jones C. Virus - Publications including interactions involving viral proteins Based on an email from the author, the BHV-1 strain cooper was stated to have been used in the study. Since no entry was found for the ICP0 from strain cooper, the Uniprot accession P29128 (ICP0_BHV1J) has been used (based on BLAST of the ICP0 sequence from fig. 6 and 100% match with P29128). cjones@unlnotes.unl.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Y., Jones C. Virus - Publications including interactions involving viral proteins Based on an email from the author, the BHV-1 strain cooper was stated to have been used in the study. Since no entry was found for the ICP0 from strain cooper, the Uniprot accession P29128 (ICP0_BHV1J) has been used (based on BLAST of the ICP0 sequence from fig. 6 and 100% match with P29128). cjones@unlnotes.unl.edu Accepted 2016-FEB-04 AT 11:40 GMT AT 11:40 GMT by MGT Journal of virology 2001 imex curation The bovine herpesvirus 1 immediate-early protein (bICP0) associates with histone deacetylase 1 to activate transcription. The bovine herpesvirus 1 immediate-early protein (bICP0) associates with histone deacetylase 1 to activate transcription. Journal of virology 2001 imex curation Zhang Y., Jones C. Virus - Publications including interactions involving viral proteins Based on an email from the author, the BHV-1 strain cooper was stated to have been used in the study. Since no entry was found for the ICP0 from strain cooper, the Uniprot accession P29128 (ICP0_BHV1J) has been used (based on BLAST of the ICP0 sequence from fig. 6 and 100% match with P29128). cjones@unlnotes.unl.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhang Y., Jones C. Virus - Publications including interactions involving viral proteins Based on an email from the author, the BHV-1 strain cooper was stated to have been used in the study. Since no entry was found for the ICP0 from strain cooper, the Uniprot accession P29128 (ICP0_BHV1J) has been used (based on BLAST of the ICP0 sequence from fig. 6 and 100% match with P29128). cjones@unlnotes.unl.edu Accepted 2016-FEB-04 AT 11:40 GMT AT 11:40 GMT by MGT Journal of virology 2001 imex curation icp0_bhv1j E3 ubiquitin-protein ligase ICP0 BICP0 IER 2.9/ER2.6 P135 protein RING-type E3 ubiquitin transferase ICP0 protein protein BoHV-1 Bovine herpesvirus 1.1 (strain Jura) Infectious bovine rhinotracheitis virus MAPPAAAPELGSCCICLDAITGAARALPCLHAFCLACIRRWLEGRPTCPLCKAPVQSLIHSVASDECFEEIPVGGGPGADGALEPDAAVIWGEDYDAGPIDLTAADGEASGAGGEAGAADGSEAGGGAGGAEEAGEARGAGAGRAAGAAGGRAGRGADAAQEFIDRVARGPRLPLLPNTPEHGPGAPYLRRVVEWVEGALVGSFAVTARELAAMTDYVMAMLAECGFDDDGLADAMEPLIGEDDAPAFVRSLLFVAARCVTVGPSHLIPQQSAPPGGRGVVFLDTSDSDSEGSEDDSWSESEESSSGLSTSDLTAIDDTETEPETDAEVESRRTRGASGAARARRPAERQYVSTRGRQTPAVQPAPRSLARRPCGRAAAVSAPPSSRSRGGRRDPRLPAAPRAAPAAQARACSPEPREEGRGAGLGVAAGETAGWGAGSEEGRGERRARLLGEAGPPRVQARRRRRTELDRAPTPAPAPAPAPAPISTVIDLTANAPARPADPAPAAAPGPASAGAQIGTPAAAAAVTAAAAAPSVARSSAPSPAVTAAATSTAAAISTRAPTPSPAGRAPAADPRRAGAPALAGAARAEVGRNGNPGRERRPASAMARGDLDPGPESSAQKRRRTEMEVAAWVRESLLGTPRRSSAALAPQPGGRQGPSLAGLLGRCSGGSAWRQ 11B06BA4E5C4EB71 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 bicp0-hdac1-1 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 7 hdac1-bicp0-1 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 7