MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2. Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2. J. Biol. Chem. (0021-9258) 2001 Block K., Boyer TG., Yew PR. Virus - Publications including interactions involving viral proteins no partial coverage rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Block K., Boyer TG., Yew PR. Virus - Publications including interactions involving viral proteins no J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2. Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2. J. Biol. Chem. (0021-9258) 2001 Block K., Boyer TG., Yew PR. Virus - Publications including interactions involving viral proteins no partial coverage rapid curation in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Block K., Boyer TG., Yew PR. Virus - Publications including interactions involving viral proteins no J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2. Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2. J. Biol. Chem. (0021-9258) 2001 Block K., Boyer TG., Yew PR. Virus - Publications including interactions involving viral proteins no partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Block K., Boyer TG., Yew PR. Virus - Publications including interactions involving viral proteins no J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2. Phosphorylation of the human ubiquitin-conjugating enzyme, CDC34, by casein kinase 2. J. Biol. Chem. (0021-9258) 2001 Block K., Boyer TG., Yew PR. Virus - Publications including interactions involving viral proteins no partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Block K., Boyer TG., Yew PR. Virus - Publications including interactions involving viral proteins no J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation csk2b_chick Casein kinase II subunit beta CSNK2B CK2N Phosvitin protein protein chick Gallus gallus (Chicken) Chicken MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR mint Participates in Wnt signaling. Plays a complex role in regulating the basal catalytic activity of the alpha subunit E465B1E699B0E0EC csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ DIP protein P68400 original sequence version: 88 DIP protein P68400 original sequence version: 78 DIP protein P68400 original sequence version: 100 DIP protein P68400 original sequence version: 110 DIP protein P68400 original sequence version: 125 DIP protein P68400 original sequence version: 136 D3B6F5D13FF7422D ub2r1_human Ubiquitin-conjugating enzyme E2 R1 Ubiquitin-protein ligase R1 Ubiquitin-conjugating enzyme E2-32 kDa complementing Ubiquitin-conjugating enzyme E2-CDC34 CDC34 UBE2R1 UBCH3 (E3-independent) E2 ubiquitin-conjugating enzyme R1 E2 ubiquitin-conjugating enzyme R1 protein protein human Homo sapiens Human MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES DIP protein P49427 original sequence version: 101 DIP protein P49427 original sequence version: 134 258960666B589DB3 csnk2b-cdc34 3 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1617876: original sequence: 1-200 : MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAP Stoichiometry: 1.0 physical association physical association mint csnk2b-cdc34-1 4 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 7 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1706591: original sequence: 1-200 : MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAP Stoichiometry: 1.0 direct interaction direct interaction mint cdc34-csnk2a1 2 6 enzyme enzyme unspecified role unspecified role purified purified Stoichiometry: 1.0 7 enzyme target enzyme target substrate substrate unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation The phosphorylation of CDC34 by casein kinase 2 moves it into the nucleus. homomint mint csnk2b-cdc34-2 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1770294: original sequence: 1-200 : MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAP tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint