MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it PDZ domain protein GIPC interacts with the cytoplasmic tail of melanosomal membrane protein gp75 (tyrosinase-related protein-1). PDZ domain protein GIPC interacts with the cytoplasmic tail of melanosomal membrane protein gp75 (tyrosinase-related protein-1). J. Biol. Chem. (0021-9258) 2001 Liu TF., Kandala G., Setaluri V. Virus - Publications including interactions involving viral proteins yeast Saccharomyces cerevisiae Baker's yeast 2h fragment pooling two hybrid fragment pooling approach 2h fragment pooling predetermined predetermined participant predetermined Liu TF., Kandala G., Setaluri V. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2001 PDZ domain protein GIPC interacts with the cytoplasmic tail of melanosomal membrane protein gp75 (tyrosinase-related protein-1). PDZ domain protein GIPC interacts with the cytoplasmic tail of melanosomal membrane protein gp75 (tyrosinase-related protein-1). J. Biol. Chem. (0021-9258) 2001 Liu TF., Kandala G., Setaluri V. Virus - Publications including interactions involving viral proteins chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Liu TF., Kandala G., Setaluri V. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2001 PDZ domain protein GIPC interacts with the cytoplasmic tail of melanosomal membrane protein gp75 (tyrosinase-related protein-1). PDZ domain protein GIPC interacts with the cytoplasmic tail of melanosomal membrane protein gp75 (tyrosinase-related protein-1). J. Biol. Chem. (0021-9258) 2001 Liu TF., Kandala G., Setaluri V. Virus - Publications including interactions involving viral proteins human-melanoma Human melanoma melanoma Melanoma anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Liu TF., Kandala G., Setaluri V. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2001 tyrp1_human 5,6-dihydroxyindole-2-carboxylic acid oxidase TYRP1 CAS2 TYRP TYRRP Catalase B Tyrosinase-related protein 1 Glycoprotein 75 Melanoma antigen gp75 protein protein human Homo sapiens Human MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIAIAVVGALLLVALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV mint Oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. May regulate or influence the type of melanin synthesized Defects in TYRP1 are the cause of rufous oculocutaneous albinism (ROCA) [MIM:278400]. ROCA occurs in blacks and is characterized by bright copper-red coloration of the skin and hair and dilution of the color of the iris Defects in TYRP1 are the cause of oculocutaneous albinism type III (OCA-III) [MIM:203290]; also known as OCA3. OCA-III is a form of albinism with only moderate reduction of pigment. Individuals with OCA-III are recognized by their reddish skin and hair color 1051CEEF52908CCA gipc1_human PDZ domain-containing protein GIPC1 C19orf3 GIPC GIPC1 RGS19IP1 RGS19-interacting protein 1 GAIP C-terminus-interacting protein RGS-GAIP-interacting protein Tax interaction protein 2 Synectin protein protein human Homo sapiens Human MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY DIP protein O14908 original sequence version: 131 AA980A4B907E3FD9 tyrp1-gipc1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:37:51 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was '534-537' range MINT-1784802: original sequence: 534-537 : EEYEKLQNPNQSV binding site binding region binding-associated region binding region inference inference modeled modelled certain certain sequence position certain certain certain sequence position certain cytoplasmic region range MINT-1784799: original sequence: 502-537 : RARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSV Stoichiometry: 1.0 5 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Stoichiometry: 1.0 physical association physical association F3B F3C F1 homomint mint tyrp1-gipc1-1 2 4 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1784840: original sequence: 1-243 : MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGRGT Stoichiometry: 1.0 physical association physical association F1B homomint mint tyrp1-gipc1-2 3 4 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:18:34 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was '523-537' range MINT-1784895: original sequence: 523-537 : AEEYEKLQNPNQSV Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Stoichiometry: 1.0 physical association physical association F2 homomint mint