HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html A genomic approach of the hepatitis C virus generates a protein interaction map. A genomic approach of the hepatitis C virus generates a protein interaction map. Gene (0378-1119) 2000 imex curation Flajolet M., Rotondo G., Daviet L., Bergametti F., Inchauspé G., Tiollais P., Transy C., Legrain P. Virus - Publications including interactions involving viral proteins plegrain@pasteur.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Flajolet M., Rotondo G., Daviet L., Bergametti F., Inchauspé G., Tiollais P., Transy C., Legrain P. Virus - Publications including interactions involving viral proteins plegrain@pasteur.fr Accepted 2013-SEP-26 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Gene (0378-1119) 2000 imex curation A genomic approach of the hepatitis C virus generates a protein interaction map. A genomic approach of the hepatitis C virus generates a protein interaction map. Gene (0378-1119) 2000 imex curation Flajolet M., Rotondo G., Daviet L., Bergametti F., Inchauspé G., Tiollais P., Transy C., Legrain P. Virus - Publications including interactions involving viral proteins plegrain@pasteur.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down autoradiography autoradiography Flajolet M., Rotondo G., Daviet L., Bergametti F., Inchauspé G., Tiollais P., Transy C., Legrain P. Virus - Publications including interactions involving viral proteins plegrain@pasteur.fr Accepted 2013-SEP-26 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Gene (0378-1119) 2000 imex curation p27958-pro_0000037566 Core protein precursor protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASA 2 191 7C9059C0D1D2732E p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 527EC748BC450589 p27958-pro_0000037569 Envelope glycoprotein E1 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) YQVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNWAKVLVVLLLFAGVDA 192 383 62EDCA90D2CEBCE8 p27958-pro_0000037570 Envelope glycoprotein E2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKYPEATYSRCGSGPRITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQAEA 384 746 9243E2103B6CCA2D p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 5601AD5882D04C8F p27958-pro_0000037576 Non-structural protein 5A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSMASSSASQLSAPSLKATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREVSVPAEILRKSRRFAPALPVWARPDYNPLLVETWKKPDYEPPVVHGCPLPPPRSPPVPPPRKKRTVVLTESTLPTALAELATKSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDVESYSSMPPLEGEPGDPDLSDGSWSTVSSGADTEDVVCC 1973 2420 106ED331CF52DACA p27958-pro_0000037572 Protease NS2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) LDTEVAASCGGVVLVGLMALTLSPYYKRYISWCMWWLQYFLTRVEAQLHVWVPPLNVRGGRDAVILLTCVVHPALVFDITKLLLAIFGPLWILQASLLKVPYFVRVQGLLRICALARKIAGGHYVQMAIIKLGALTGTCVYNHLAPLRDWAHNGLRDLAVAVEPVVFSRMETKLITWGADTAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLL 810 1026 2036555B07778591 ns5a-e1-1 1 E1 5 unspecified role unspecified role prey prey NS5A 8 unspecified role unspecified role bait bait physical association physical association Fig. 3 ns4a-ns3-2 1 NS3 7 unspecified role unspecified role prey prey NS4A 4 unspecified role unspecified role bait bait physical association physical association Fig. 3 ns4a-ns2-5 1 NS2 9 unspecified role unspecified role prey prey NS4A 4 unspecified role unspecified role bait bait physical association physical association Fig. 3 p27958_pr-p27958_p-2 1 Core 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3 ns4a-ns3-3 1 NS3 7 unspecified role unspecified role bait bait N-terminal domain bind to NS4A NS4A 4 unspecified role unspecified role prey prey physical association physical association Fig. 5 ns3-e2-1 1 NS3 7 unspecified role unspecified role bait bait E2 6 unspecified role unspecified role prey prey physical association physical association Fig. 5 ns4a-ns2-1 2 NS2 9 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro NS4A 4 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 6