HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. J. Virol. (0022-538X) 2000 imex curation Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp Accepted 2014-MAR-31 by ORCHARD J. Virol. (0022-538X) 2000 imex curation Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. J. Virol. (0022-538X) 2000 imex curation Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp Accepted 2014-MAR-31 by ORCHARD Human liver cDNA J. Virol. (0022-538X) 2000 imex curation Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. J. Virol. (0022-538X) 2000 imex curation Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp Accepted 2014-MAR-31 by ORCHARD J. Virol. (0022-538X) 2000 imex curation Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. J. Virol. (0022-538X) 2000 imex curation Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp Accepted 2014-MAR-31 by ORCHARD J. Virol. (0022-538X) 2000 imex curation Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1. J. Virol. (0022-538X) 2000 imex curation Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down autoradiography autoradiography Aoki H., Hayashi J., Moriyama M., Arakawa Y., Hino O. Virus - Publications including interactions involving viral proteins ohino@ims.u-tokyo.ac.jp Accepted 2014-MAR-31 by ORCHARD J. Virol. (0022-538X) 2000 imex curation 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 mrcka_human Serine/threonine-protein kinase MRCK alpha CDC42BPA KIAA0451 Myotonic dystrophy kinase-related CDC42-binding kinase alpha DMPK-like alpha CDC42-binding protein kinase alpha protein protein human Homo sapiens Human MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFERSPSCTPASKGRRTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVISQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSGKVRHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGNPYSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNNEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSDAPARDFDGEDSDSPRHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP 48B10F81B5405A0A o92972-pro_0000278742 Core protein precursor protein protein hcvj4 Hepatitis C virus genotype 1b (strain HC-J4) (HCV) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKASERSQPRGRRQPIPKARRPEGRAWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASA 2 191 BF447DB8C5485B27 1433b_rat 14-3-3 protein beta/alpha Protein kinase C inhibitor protein 1 Prepronerve growth factor RNH-1 Ywhab protein protein rat Rattus norvegicus (Rat) Rat MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICSDVLELLDKYLILNATHAESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN B663D1F2182F9C43 bmh1_yeast Protein BMH1 YER177W BMH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAEDQQQQQQHQQQQPPAAAEGEAPK 0A234167E313688B 0A234167E313688B core-1433e-4 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Results core-1433e-1 3 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O92972-PRO_0000278742:p.Glu53Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:23:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu53ala' Tue Jun 30 20:14:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu53Ala' 18 16 physical association physical association Fig. 1 core-1433e-2 5 6 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig. 2A and 2B Treatment with PKA or PKC enhance interaction core-1433b-1 5 9 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig. 2A core-bmh1-1 5 8 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast 10 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association Fig. 2A core-1433e-3 4 6 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait O92972-PRO_0000278742:p.Glu53Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Wed May 02 18:14:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu53ala' Tue Jun 30 18:45:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu53Ala' physical association physical association Fig. 2C core-mrcka-1 2 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Results core-1433e-5 1 6 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey O92972-PRO_0000278742:p.Glu53Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:59:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu53ala' Tue Jun 30 18:30:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu53Ala' physical association physical association Fig. 2C