MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Colocalization of the herpes simplex virus 1 UL4 protein with infected cell protein 22 in small, dense nuclear structures formed prior to onset of DNA synthesis. Colocalization of the herpes simplex virus 1 UL4 protein with infected cell protein 22 in small, dense nuclear structures formed prior to onset of DNA synthesis. J. Virol. (0022-538X) 1999 rapid curation Jahedi S., Markovitz NS., Filatov F., Roizman B. Virus - Publications including interactions involving viral proteins suggested by aceol rapid curation unknown Unknown imaging technique imaging technique microscopy predetermined predetermined participant predetermined Jahedi S., Markovitz NS., Filatov F., Roizman B. Virus - Publications including interactions involving viral proteins suggested by aceol J. Virol. (0022-538X) 1999 rapid curation rapid curation np04_hhv11 Nuclear protein UL4 UL4 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MSNPQTTIAYSLCHARASLTSALPDAAQVVHVFEYGTRAIMVRGRERQDRLPRGGVVIQHTPIGLLVIIDCRAEFCAYRFIGRDSNQKLERGWDAHMYAYPFDSWVSSSRGESARSATAGILTVVWTADTIYITATIYGSPPEETPGAAHGVGAAPPPPTTACPGTAEFLQPTADLLVEVLREIQLSPALEYADKLLGS mint A50C0AB9FB9AA3F0 icp22_hhv11 Transcriptional regulator ICP22 ICP22 Immediate-early protein IE68 Infected cell protein 22 US1 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MADISPGAFAPCVKARRPALRSPPLGTRKRKRPSRPLSSESEVESDTALESEVESETASDSTESGDQDEAPRIGGRRAPRRLGGRFFLDMSAESTTGTETDASVSDDPDDTSDWSYDDIPPRPKRARVNLRLTSSPDRRDGVIFPKMGRVRSTRETQPRAPTPSAPSPNAMLRRSVRQAQRRSSARWTPDLGYMRQCINQLFRVLRVARDPHGSANRLRHLIRDCYLMGYCRARLAPRTWCRLLQVSGGTWGMHLRNTIREVEARFDATAEPVCKLPCLETRRYGPECDLSNLEIHLSATSDDEISDATDLEAAGSDHTLASQSDTEDAPSPVTLETPEPRGSLAVRLEDEFGEFDWTPQEGSQPWLSAVVADTSSVERPGPSDSGAGRAAEDRKCLDGCRKMRFSTACPYPCSDTFLRP Deregulates cell cycle by inducing the loss of RNA polymerase II Ser-2 phosphorylation on its C-terminal domain mint 94D56376545B1192 icp22-np04 1 2 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component colocalization colocalization F3 F4 homomint mint