IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells. Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells. J. Cell Biol. (0021-9525) 1998 Cohen AR., Woods DF., Marfatia SM., Walther Z., Chishti AH., Anderson JM., Wood DF. Synapse - Interactions of proteins with an established role in the presynapse. Colocalisation studies not added as text says rat, figure legend says mouse and M&M says nothing. james.anderson@yale.edu 26-APR-2007: Contacted by JYOTI. Human fetal brain cDNA in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cohen AR., Woods DF., Marfatia SM., Walther Z., Chishti AH., Anderson JM., Wood DF. Synapse - Interactions of proteins with an established role in the presynapse. Colocalisation studies not added as text says rat, figure legend says mouse and M&M says nothing. Peptide coupled to CNBr-activated Sepharose beads. james.anderson@yale.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Human fetal brain cDNA J. Cell Biol. (0021-9525) 1998 Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells. Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells. J. Cell Biol. (0021-9525) 1998 Cohen AR., Woods DF., Marfatia SM., Walther Z., Chishti AH., Anderson JM., Wood DF. Synapse - Interactions of proteins with an established role in the presynapse. Colocalisation studies not added as text says rat, figure legend says mouse and M&M says nothing. james.anderson@yale.edu 26-APR-2007: Contacted by JYOTI. Human fetal brain cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cohen AR., Woods DF., Marfatia SM., Walther Z., Chishti AH., Anderson JM., Wood DF. Synapse - Interactions of proteins with an established role in the presynapse. Colocalisation studies not added as text says rat, figure legend says mouse and M&M says nothing. james.anderson@yale.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Human fetal brain cDNA J. Cell Biol. (0021-9525) 1998 Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells. Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells. J. Cell Biol. (0021-9525) 1998 Cohen AR., Woods DF., Marfatia SM., Walther Z., Chishti AH., Anderson JM., Wood DF. Synapse - Interactions of proteins with an established role in the presynapse. Colocalisation studies not added as text says rat, figure legend says mouse and M&M says nothing. james.anderson@yale.edu 26-APR-2007: Contacted by JYOTI. Human fetal brain cDNA in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Cohen AR., Woods DF., Marfatia SM., Walther Z., Chishti AH., Anderson JM., Wood DF. Synapse - Interactions of proteins with an established role in the presynapse. Colocalisation studies not added as text says rat, figure legend says mouse and M&M says nothing. james.anderson@yale.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Human fetal brain cDNA J. Cell Biol. (0021-9525) 1998 epb41_human Protein 4.1 Band 4.1 EPB4.1 4.1R EPB41 E41P Erythrocyte membrane protein band 4.1 protein protein human Homo sapiens Human MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDTPTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKVEKTHIEVTVPTSNGDQTQKLAEKTEDLIRMRKKKRERLDGENIYIRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLDPGVLLTAQTITSETPSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEIADE B466E7A9D7FBF12B cskp_human Peripheral plasma membrane protein CASK CASK LIN2 Calcium/calmodulin-dependent serine protein kinase Protein lin-2 homolog protein protein human Homo sapiens Human MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 6C02008CE52728BA sdc2_human Syndecan-2 SDC2 HSPG1 Fibroglycan Heparan sulfate proteoglycan core protein protein protein human Homo sapiens Human MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA DIP protein P34741 original sequence version: 74 DIP protein P34741 original sequence version: 119 DIP protein P34741 original sequence version: 102 7DA4159D54741054 cask-sdc2-1 2 6 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait pdz domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association We detect in a yeast two-hybrid screen that the PDZ domain of hCASK binds to the heparan sulfate proteoglycan syndecan-2 cask-sdc2-2 1 6 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 5 unspecified role unspecified role prey prey pdz domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 40-70uM soluble SDC2 or SDC1 peptide Direct binding study with syn-2 peptide and hCASK PDZ fusion protein. 5B cask-epb41-1 3 4 unspecified role unspecified role bait bait region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-erythrocyte Homo sapiens erythrocyte Erythrocyte, Red blood cell; Corpuscle; RBC 5 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction EPB41 was a 30kDa fragment, but this could not be mapped to the given sequence In a blot overlay assay, a 125I-labeled 30-kD fragment of protein 4.1 was incubated with fusion proteins GSThCASK, 7 Excess of nonradiolabeled EPB41.