IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease. An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease. Nature (0028-0836) 1997 Yan SD., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collison K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Synapse - Interactions of proteins with an established role in the presynapse. Apoptosis - Interactions involving proteins with a function related to apoptosis Amyloid beta peptide was radiolabelled and incubated with neuroblastoma cells. ERAB was immunoprecipitated after cross-linking. sdy1@columbia.edu in vitro In vitro biochemical biochemical predetermined predetermined participant predetermined Yan SD., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collison K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D. Alzheimers - Interactions investigated in the context of Alzheimers disease revisit when ligand binding in place. Amyloid beta peptide was radiolabelled and incubated with neuroblastoma cells. ERAB was immunoprecipitated after cross-linking. sdy1@columbia.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 1997 An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease. An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease. Nature (0028-0836) 1997 Yan SD., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collison K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Synapse - Interactions of proteins with an established role in the presynapse. Apoptosis - Interactions involving proteins with a function related to apoptosis Amyloid beta peptide was radiolabelled and incubated with neuroblastoma cells. ERAB was immunoprecipitated after cross-linking. sdy1@columbia.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yan SD., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collison K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D. Alzheimers - Interactions investigated in the context of Alzheimers disease Amyloid beta peptide was radiolabelled and incubated with neuroblastoma cells. ERAB was immunoprecipitated after cross-linking. sdy1@columbia.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 1997 An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease. An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease. Nature (0028-0836) 1997 Yan SD., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collison K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Synapse - Interactions of proteins with an established role in the presynapse. Apoptosis - Interactions involving proteins with a function related to apoptosis Amyloid beta peptide was radiolabelled and incubated with neuroblastoma cells. ERAB was immunoprecipitated after cross-linking. sdy1@columbia.edu in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Yan SD., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collison K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D. Alzheimers - Interactions investigated in the context of Alzheimers disease Amyloid beta peptide was radiolabelled and incubated with neuroblastoma cells. ERAB was immunoprecipitated after cross-linking. sdy1@columbia.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 1997 An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease. An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease. Nature (0028-0836) 1997 Yan SD., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collison K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease Synapse - Interactions of proteins with an established role in the presynapse. Apoptosis - Interactions involving proteins with a function related to apoptosis Amyloid beta peptide was radiolabelled and incubated with neuroblastoma cells. ERAB was immunoprecipitated after cross-linking. sdy1@columbia.edu human Homo sapiens Human crosslink cross-linking study crosslink predetermined predetermined participant predetermined Yan SD., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collison K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D. Alzheimers - Interactions investigated in the context of Alzheimers disease Amyloid beta peptide was radiolabelled and incubated with neuroblastoma cells. ERAB was immunoprecipitated after cross-linking. sdy1@columbia.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 1997 hcd2_human 3-hydroxyacyl-CoA dehydrogenase type-2 HSD17B10 SCHAD XH98G2 HADH2 3-hydroxyacyl-CoA dehydrogenase type II Type II HADH 3-hydroxy-2-methylbutyryl-CoA dehydrogenase Endoplasmic reticulum-associated amyloid beta-peptide-binding protein Short-chain type dehydrogenase/reductase XH98G2 Mitochondrial ribonuclease P protein 2 2-methyl-3-hydroxybutyryl-CoA dehydrogenase ERAB MRPP2 SDR5C1 Short chain dehydrogenase/reductase family 5C member 1 17-beta-estradiol 17-dehydrogenase 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)) 3alpha(or 20beta)-hydroxysteroid dehydrogenase 7-alpha-hydroxysteroid dehydrogenase protein protein human Homo sapiens Human MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP 9E74F242E3E6FEF1 a4_human Amyloid-beta precursor protein APP A4 AD1 Alzheimer disease amyloid protein ABPP PreA4 Cerebral vascular amyloid peptide Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN DIP protein P05067 original sequence version: 160 DIP protein P05067 original sequence version: 207 DIP protein P05067 original sequence version: 185 DIP protein P05067 original sequence version: 188 A12EE761403740F5 hadh2-app-1 2 6 unspecified role unspecified role bait bait amyloid beta 42 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association hadh2-app-2 4 6 unspecified role unspecified role neutral component neutral component amyloid beta 42 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component physical association physical association app-hadh2-1 1 6 unspecified role unspecified role bait bait amyloid beta 42 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey 125i radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association app-hadh2-2 3 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait amyloid beta 42 Amyloid beta peptide 42 is amono acids 672-713 of APP binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association