IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. Exp. Mol. Med. (1226-3613) 2013 imex curation Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Synapse - Interactions of proteins with an established role in the presynapse. GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr Accepted 2013-NOV-20 by PPORRAS 22-Nov-2013: Contacted by IntAct-Help. Exp. Mol. Med. (1226-3613) 2013 Only protein-protein interactions imex curation LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. Exp. Mol. Med. (1226-3613) 2013 imex curation Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Synapse - Interactions of proteins with an established role in the presynapse. GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr Accepted 2013-NOV-20 by PPORRAS 22-Nov-2013: Contacted by IntAct-Help. Exp. Mol. Med. (1226-3613) 2013 Only protein-protein interactions imex curation LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. Exp. Mol. Med. (1226-3613) 2013 imex curation Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Synapse - Interactions of proteins with an established role in the presynapse. GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr Accepted 2013-NOV-20 by PPORRAS 22-Nov-2013: Contacted by IntAct-Help. Exp. Mol. Med. (1226-3613) 2013 Only protein-protein interactions imex curation LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. Exp. Mol. Med. (1226-3613) 2013 imex curation Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr Accepted 2013-NOV-20 by PPORRAS 22-Nov-2013: Contacted by IntAct-Help. Exp. Mol. Med. (1226-3613) 2013 Only protein-protein interactions imex curation LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. Exp. Mol. Med. (1226-3613) 2013 imex curation Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Synapse - Interactions of proteins with an established role in the presynapse. GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr Accepted 2013-NOV-20 by PPORRAS 22-Nov-2013: Contacted by IntAct-Help. Exp. Mol. Med. (1226-3613) 2013 Only protein-protein interactions imex curation LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25. Exp. Mol. Med. (1226-3613) 2013 imex curation Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yun H.J., Park J., Ho D.H., Kim H., Kim C.H., Oh H., Ga I., Seo H., Chang S., Son I., Seol W. Synapse - Interactions of proteins with an established role in the presynapse. Synapse - Interactions of proteins with an established role in the presynapse. GST-SNAP-25:- a gift from Sheng Z.H. This construct had been entered as Rattine in origin - see Yokoyama CT et al., 1997 PMID: 9278528. The Interactions shown in figure 5 (syntaxin IP) cannot be included due to the lack of specificity of the anti-syntaxin antibody used. Results from the in vitro Kinase assay (Figure 1A) have not been included as the purification (IP only) may not have been sufficient. sonih@wku.ac.kr,wseol@wmcsb.co.kr Accepted 2013-NOV-20 by PPORRAS 22-Nov-2013: Contacted by IntAct-Help. Exp. Mol. Med. (1226-3613) 2013 Only protein-protein interactions imex curation snapn_mouse SNARE-associated protein Snapin Snapin Snap25bp Snapap Synaptosomal-associated protein 25-binding protein Biogenesis of lysosome-related organelles complex 1 subunit 7 Bloc1s7 protein protein mouse Mus musculus Mouse MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK C81AC2ABCDCA21FA snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60881 original sequence version: 105 DIP protein P60881 original sequence version: 40 DIP protein P60881 original sequence version: 106 DIP protein P60881 original sequence version: 78 DIP protein P60881 original sequence version: 75 DIP protein P60881 original sequence version: 100 DIP protein P60881 original sequence version: 120 DIP protein P60881 original sequence version: 131 DIP protein P60881 original sequence version: 93 FBED2B082A4CB6A6 snapn_human SNARE-associated protein Snapin SNAPIN SNAP25BP SNAPAP Synaptosomal-associated protein 25-binding protein BLOC1S7 Biogenesis of lysosome-related organelles complex 1 subunit 7 protein protein human Homo sapiens Human MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK 3EA402AC53C81FFF snp25_mouse Synaptosomal-associated protein 25 Synaptosomal-associated 25 kDa protein Super protein Snap25 Snap protein protein mouse Mus musculus Mouse MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60879 original sequence version: 38 DIP protein P60879-1 original sequence version: 41 DIP protein P60879-1 original sequence version: 109 DIP protein P60879-1 original sequence version: 81 DIP protein P60879 original sequence version: 111 FBED2B082A4CB6A6 lrrk2_human Leucine-rich repeat serine/threonine-protein kinase 2 LRRK2 PARK8 Dardarin protein protein human Homo sapiens Human MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE DIP protein Q5S007 original sequence version: 36 DIP protein Q5S007 original sequence version: 68 DIP protein Q5S007 original sequence version: 64 26142A0CECBBC3F4 lrrk2-snapin 3 9 enzyme target enzyme target substrate substrate unspecified role unspecified role O95295:p.Thr117Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain T A Wed May 02 14:35:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr117ala' Tue Jun 30 18:41:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Ala' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range phosphorylation phosphorylation reaction phosphorylation 1B, 1D lrrk2-1 3 11 putative self putative self putative self putative self region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range phosphorylation phosphorylation reaction phosphorylation true 1B snapin-lrrk2 1 11 unspecified role unspecified role prey prey n_terminal_d_apai_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain roc_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2A/B, 3B All tested LRRK2 domain constructs except the Kinase domain construct interacted with Snapin. lrrk2-snapin-1 5 9 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2C lrrk2-snapin-2 4 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 2D lrrk2-snapin-3 6 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure I have not added a "sufficient to bind" region for LRRK2 as it is not stated which is the shortest binding region (s) and no aa nos are given for WD 40 domain. snap25-snapin 1 8 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey O95295:p.Thr117Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T D Wed May 02 16:04:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr117asp' Tue Jun 30 17:23:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Asp' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 A/B Snapin, under conditions which might have resulted in its phosphorylation by LRRK2, showed a considerably decreased interaction with SNAP-25. snap25-snapin-1 2 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 4C The i nteraction of SNAP25 with Snapin was weaker when G2019S LRRK2 was present rather than non-mutated LRRK2.