IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery J Immunol 2009 imex curation Chaofeng Han, Taoyong Chen, Mingjin Yang, Nan Li, Haibo Liu, Xuetao Cao Synapse - Interactions of proteins with an established role in the presynapse. caoxt@public3.sta.net.cn 25-Jun-2010: Contacted by JYOTI. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chaofeng Han, Taoyong Chen, Mingjin Yang, Nan Li, Haibo Liu, Xuetao Cao Synapse - Interactions of proteins with an established role in the presynapse. caoxt@public3.sta.net.cn Accepted 2010-JUL-8 by ORCHARD. J Immunol 2009 Only protein-protein interactions imex curation Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery J Immunol 2009 imex curation Chaofeng Han, Taoyong Chen, Mingjin Yang, Nan Li, Haibo Liu, Xuetao Cao Synapse - Interactions of proteins with an established role in the presynapse. caoxt@public3.sta.net.cn 25-Jun-2010: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chaofeng Han, Taoyong Chen, Mingjin Yang, Nan Li, Haibo Liu, Xuetao Cao Synapse - Interactions of proteins with an established role in the presynapse. caoxt@public3.sta.net.cn Accepted 2010-JUL-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. J Immunol 2009 Only protein-protein interactions imex curation Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery J Immunol 2009 imex curation Chaofeng Han, Taoyong Chen, Mingjin Yang, Nan Li, Haibo Liu, Xuetao Cao Synapse - Interactions of proteins with an established role in the presynapse. caoxt@public3.sta.net.cn 25-Jun-2010: Contacted by JYOTI. Only protein-protein interactions mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chaofeng Han, Taoyong Chen, Mingjin Yang, Nan Li, Haibo Liu, Xuetao Cao Synapse - Interactions of proteins with an established role in the presynapse. caoxt@public3.sta.net.cn Accepted 2010-JUL-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. J Immunol 2009 Only protein-protein interactions imex curation syt2_mouse Synaptotagmin-2 Syt2 Inositol polyphosphate-binding protein Synaptotagmin II protein protein mouse Mus musculus Mouse MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK DIP protein P46097 original sequence version: 113 DIP protein P46097 original sequence version: 117 B4BD13FF70E0481B snp23_human Synaptosomal-associated protein 23 Vesicle-membrane fusion protein SNAP-23 SNAP23 protein protein human Homo sapiens Human MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLIDS AC378E9786C3A239 vamp3_human Vesicle-associated membrane protein 3 Synaptobrevin-3 Cellubrevin VAMP3 SYB3 protein protein human Homo sapiens Human MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS DIP protein Q15836 original sequence version: 141 347E9163157AFF42 stx4_human Syntaxin-4 Renal carcinoma antigen NY-REN-31 STX4 STX4A protein protein human Homo sapiens Human MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG 5084FD1C49A86BAA stx6_human Syntaxin-6 STX6 protein protein human Homo sapiens Human MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL DIP protein O43752 original sequence version: 117 DIP protein O43752 original sequence version: 129 DIP protein O43752 original sequence version: 134 CC05C025DE1FE89E scam5_human Secretory carrier-associated membrane protein 5 SCAMP5 protein protein human Homo sapiens Human MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM D3CFF3C9EF2FC6FF vamp4_human Vesicle-associated membrane protein 4 VAMP4 protein protein human Homo sapiens Human MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT DIP protein O75379 original sequence version: 118 DIP protein O75379 original sequence version: 128 DIP protein O75379 original sequence version: 133 556CC682D26CF91E stx8_human Syntaxin-8 STX8 protein protein human Homo sapiens Human MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCGMIMVILLLLVAIVVVAVWPTN DIP protein Q9UNK0 original sequence version: 153 DIP protein Q9UNK0 original sequence version: 119 DIP protein Q9UNK0 original sequence version: 100 DIP protein Q9UNK0 original sequence version: 114 1E64A0DA77584CC4 syt1_mouse Synaptotagmin-1 Synaptotagmin I p65 Syt1 protein protein mouse Mus musculus Mouse MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P46096 original sequence version: 132 7FDEFF37170BD169 scamp5-snap23 1 9 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association Fig 7A scamp5-syt1 2 12 unspecified role unspecified role prey prey mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 4 unspecified role unspecified role prey prey mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 9 unspecified role unspecified role bait bait n-term n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-term c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig 7B Lipopolysaccharide syt1-scamp5 3 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 7D Ionomycin syt2-scamp5 3 4 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 7D Ionomycin