IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding. Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding. Cell (0092-8674) 2007 imex curation Fisher RD., Chung HY., Zhai Q., Robinson H., Sundquist WI., Hill CP. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. To find the position of YP->SR mutations in Gag proteins the motif YPXnL was searched for (where n= 1-3). Only one site was found in each protein. For the Gag proteins, in each case there were different UniProt entries corresponding to different viral isolates in each case the longest was taken and where there were 2 of equal longest length the first in the list was taken. wes@biochem.utah.edu,chris@biochem.utah.edu 26-APR-2007: Contacted by JYOTI. Only protein-protein interactions 8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fisher RD., Chung HY., Zhai Q., Robinson H., Sundquist WI., Hill CP. Apoptosis - Interactions involving proteins with a function related to apoptosis To find the position of YP->SR mutations in Gag proteins the motif YPXnL was searched for (where n= 1-3). Only one site was found in each protein. For the Gag proteins, in each case there were different UniProt entries corresponding to different viral isolates in each case the longest was taken and where there were 2 of equal longest length the first in the list was taken. wes@biochem.utah.edu,chris@biochem.utah.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding. Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding. Cell (0092-8674) 2007 imex curation Fisher RD., Chung HY., Zhai Q., Robinson H., Sundquist WI., Hill CP. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. To find the position of YP->SR mutations in Gag proteins the motif YPXnL was searched for (where n= 1-3). Only one site was found in each protein. For the Gag proteins, in each case there were different UniProt entries corresponding to different viral isolates in each case the longest was taken and where there were 2 of equal longest length the first in the list was taken. wes@biochem.utah.edu,chris@biochem.utah.edu 26-APR-2007: Contacted by JYOTI. Only protein-protein interactions 8 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Fisher RD., Chung HY., Zhai Q., Robinson H., Sundquist WI., Hill CP. Apoptosis - Interactions involving proteins with a function related to apoptosis To find the position of YP->SR mutations in Gag proteins the motif YPXnL was searched for (where n= 1-3). Only one site was found in each protein. For the Gag proteins, in each case there were different UniProt entries corresponding to different viral isolates in each case the longest was taken and where there were 2 of equal longest length the first in the list was taken. wes@biochem.utah.edu,chris@biochem.utah.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding. Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding. Cell (0092-8674) 2007 imex curation Fisher RD., Chung HY., Zhai Q., Robinson H., Sundquist WI., Hill CP. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. To find the position of YP->SR mutations in Gag proteins the motif YPXnL was searched for (where n= 1-3). Only one site was found in each protein. For the Gag proteins, in each case there were different UniProt entries corresponding to different viral isolates in each case the longest was taken and where there were 2 of equal longest length the first in the list was taken. wes@biochem.utah.edu,chris@biochem.utah.edu 26-APR-2007: Contacted by JYOTI. Only protein-protein interactions 8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fisher RD., Chung HY., Zhai Q., Robinson H., Sundquist WI., Hill CP. Apoptosis - Interactions involving proteins with a function related to apoptosis To find the position of YP->SR mutations in Gag proteins the motif YPXnL was searched for (where n= 1-3). Only one site was found in each protein. For the Gag proteins, in each case there were different UniProt entries corresponding to different viral isolates in each case the longest was taken and where there were 2 of equal longest length the first in the list was taken. wes@biochem.utah.edu,chris@biochem.utah.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation chm4a_human Charged multivesicular body protein 4a Chromatin-modifying protein 4a Vacuolar protein sorting-associated protein 32-1 SNF7-1 SNF7 homolog associated with Alix-2 CHMP4A C14orf123 SHAX2 CDA04 HSPC134 protein protein human Homo sapiens Human MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS DIP protein Q9BY43 original sequence version: 62 DIP protein Q9BY43 original sequence version: 98 6712BA6AAA1D7CB7 gag_hv1b1 Gag polyprotein gag Pr55Gag protein protein hv1b1 Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) HIV-1 MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSSQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNTATIMMQRGNFRNQRKMVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ 535DA188EE80D444 sh3g2_human Endophilin-A1 SH3GL2 CNSA2 SH3D2A Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A EEN-B1 protein protein human Homo sapiens Human MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH DIP protein Q99962 original sequence version: 111 DIP protein Q99962 original sequence version: 141 F3AE2353E1EB7CF3 gag_eiav9 Gag polyprotein gag protein protein eiav9 Equine infectious anemia virus (isolate 1369) (EIAV) MGDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWAISAVKMGLQINNVVDGKASFQLLRAKYEKKTANKKQSEPSEEYPIMIDGAGNRNFRPLTPRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIGTTKQKMMLLAKALQTGLAGPFKGGALKGGPLKAAQTCYNCGKPGHLSSQCRAPKVCFKCKQPGHFSKQCRSVPKNGKQGAQGRPQKQTFPIQQKSQHNKSVVQETPQTQNLYPDLSEIKKEYNVKEKDQVEDLNLDSLWE 97137FA5933D1DDA sh3g1_human Endophilin-A2 Endophilin-2 SH3 domain-containing GRB2-like protein 1 SH3 domain protein 2B Extra eleven-nineteen leukemia fusion gene protein EEN fusion partner of MLL SH3GL1 CNSA1 SH3D2B protein protein human Homo sapiens Human MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ 6E5BE978BC955077 6E5BE978BC955077 ts101_human Tumor susceptibility gene 101 protein TSG101 ESCRT-I complex subunit TSG101 protein protein human Homo sapiens Human MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY ADD6912FC22DF162 pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ DIP protein Q8WUM4 original sequence version: 46 DIP protein Q8WUM4 original sequence version: 67 DIP protein Q8WUM4 original sequence version: 60 DIP protein Q8WUM4 original sequence version: 64 DIP protein Q8WUM4 original sequence version: 66 DIP protein Q8WUM4 original sequence version: 89 DIP protein Q8WUM4 original sequence version: 100 DIP protein Q8WUM4-1 original sequence version: 145 DIP protein Q8WUM4-1 original sequence version: 137 DIP protein Q8WUM4-1 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 106 573588D1F612EC93 pdcd6ip-gag 2 5 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8WUM4:p.Val498Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Wed May 02 15:25:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val498asp' Tue Jun 30 16:56:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val498Asp' Q8WUM4:p.Phe676Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D Wed May 02 17:46:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe676asp' Tue Jun 30 15:56:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe676Asp' Q8WUM4:p.Ile683Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I D Wed May 02 18:55:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile683asp' Tue Jun 30 19:12:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile683Asp' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association 3 A, Table S2 the immobilized ALIX V domain bound both HIV-1 p6Gag and EIAV p9Ga pdcd6ip-gag-1 2 5 unspecified role unspecified role prey prey P03347:p.Tyr496_Pro497delinsSerArg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain YP SR Fri Jul 22 11:01:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr496ser,pro497arg' Wed May 02 19:39:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr_pro496-497ser_arg' Tue Jun 30 19:59:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr496_Pro497delinsSerArg' ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association 3 A, Table S2 the immobilized ALIX V domain bound both HIV-1 p6Gag and EIAV p9Ga The mutation of YP to SR in the Gag YPX(n)L late domain reduced binding affinity substantially (over 15-fold). pdcd6ip-gag-2 2 7 unspecified role unspecified role prey prey P69730:p.[Tyr458Ser;Pro459Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y S certain certain sequence position certain certain certain sequence position certain P R Wed May 02 18:42:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr458ser,pro459arg' Tue Jun 30 18:46:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr458Ser;Pro459Arg]' ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association 3 A, Table S2 the immobilized ALIX V domain bound both HIV-1 p6Gag and EIAV p9Ga The mutation of YP to SR in the Gag YPX(n)L late domain reduced binding affinity substantially (over 15-fold). pdcd6ip-gag-3 2 7 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8WUM4:p.Val498Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Wed May 02 14:28:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val498asp' Tue Jun 30 18:07:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val498Asp' Q8WUM4:p.Phe676Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D Wed May 02 16:35:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe676asp' Tue Jun 30 17:49:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe676Asp' Q8WUM4:p.Ile683Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I D Wed May 02 17:04:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile683asp' Tue Jun 30 19:57:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile683Asp' ecobb Escherichia coli (strain B / BL21) physical association physical association 3 A, Table S2 the immobilized ALIX V domain bound both HIV-1 p6Gag and EIAV p9Ga ALIX V (V498D) Kd =1.8 E-9 M; ALIX V (I593D) 5.8 E-7 M. pdcd6ip-chmp4a 1 10 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8WUM4:p.Ile212Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I D Wed May 02 17:38:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile212asp' Tue Jun 30 16:44:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile212Asp' ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 6 B As expected, wild-type ALIXBro1 bound to a GST-CHMP4A fusion protein but not to GST alone (compare lanes 2 and 3). In contrast, the ALIXBro1,I212D mutant did not bind GST-CHMP4A detectably pdcd6ip-tsg101 2 10 unspecified role unspecified role bait bait Q8WUM4:p.Pro720Leu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Wed May 02 18:10:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro720leu' Tue Jun 30 18:48:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro720Leu' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role prey prey n-terminal UEV domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association S5 A mutation of the final proline in the 717PSAP720 motif (Pro720Leu) eliminated TSG101 UEV binding entirely The mutation Pro720Leu in the PSAP motif of ALIX714-723 eliminates binding to TSG101 UEV domain. pdcd6ip-sh3gl2 3 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey Q8WUM4:p.[Arg757Ala;Pro758Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:45:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg757ala,pro758ala' Tue Jun 30 17:32:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg757Ala;Pro758Ala]' physical association physical association S5 B Yeast two hybrid assay showing that human ALIX binds endophilins-1 and -2, and that the interactions are inhibited by the ALIX RP757,758AA mutation. pdcd6ip-sh3gl1 3 10 unspecified role unspecified role prey prey Q8WUM4:p.[Arg757Ala;Pro758Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 20:23:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg757ala,pro758ala' Tue Jun 30 17:54:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg757Ala;Pro758Ala]' 8 unspecified role unspecified role bait bait physical association physical association S5 B Yeast two hybrid assay showing that human ALIX binds endophilins-1 and -2, and that the interactions are inhibited by the ALIX RP757,758AA mutation.