MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. EMBO J. (0261-4189) 2006 imex curation He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. This experiment relates to a negative interaction. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu schner01@popmail.med.nyu.edu or schner01@med.nyu.edu Accepted 2006-NOV-10 by ORCHARD. EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation 1433s_human 14-3-3 protein sigma Stratifin Epithelial cell marker protein 1 HME1 SFN protein protein human Homo sapiens Human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS DIP protein P31947 original sequence version: 84 7F4B44E3AA59ECE6 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN DIP protein P61981 original sequence version: 126 DIP protein P61981 original sequence version: 135 B0D16C6DE1F4455D q14103-1 Heterogeneous nuclear ribonucleoprotein D0 p45 Dx9 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY D0B6EA177BEF789E q14103-4 Heterogeneous nuclear ribonucleoprotein D0 p37 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 263. Contains a N6-acetyllysine at position 273. 98DF6E78EAF3BBC1 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 q14103-2 Heterogeneous nuclear ribonucleoprotein D0 p42 Dx4 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY FEE18D61B7714B51 ywhaz-hnrpd 1 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction true 2B Under identical binding conditions, recombinant purified p37 AUF1 was found to interact strongly with 14-3-3s, to a lesser extent with 14-3-3Z, but not with 14-3-3z (Figure 2B). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation hnrpd-ywhah 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction true 1C the His-p37 recovery assay suggested that only the sigma isoform, but not the g or b/z isoforms, of 14-3-3 binds to p37 AUF1 (Figure 1C) AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation sfn-hnrpd-4 1 7 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction true 3B The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45 (Figure 3B). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45. sfn-hnrpd-5 1 2 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey direct interaction direct interaction true 3B The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45 (Figure 3B). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45. ywhaz-hnrpd-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction true 1C the His-p37 recovery assay suggested that only the sigma isoform, but not the g or b/z isoforms, of 14-3-3 binds to p37 AUF1 (Figure 1C). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation