MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. EMBO J. (0261-4189) 2006 imex curation He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu schner01@popmail.med.nyu.edu or schner01@med.nyu.edu Accepted 2006-NOV-10 by ORCHARD. EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. EMBO J. (0261-4189) 2006 imex curation He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu schner01@popmail.med.nyu.edu or schner01@med.nyu.edu Accepted 2006-NOV-10 by ORCHARD. EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. EMBO J. (0261-4189) 2006 imex curation He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu schner01@popmail.med.nyu.edu or schner01@med.nyu.edu Accepted 2006-NOV-10 by ORCHARD. EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation 1433s_human 14-3-3 protein sigma Stratifin Epithelial cell marker protein 1 HME1 SFN protein protein human Homo sapiens Human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS DIP protein P31947 original sequence version: 84 7F4B44E3AA59ECE6 q14103-3 Heterogeneous nuclear ribonucleoprotein D0 p40 Dx7 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 282. Contains a N6-acetyllysine at position 292. ABCDD6ACF812F647 q14103-4 Heterogeneous nuclear ribonucleoprotein D0 p37 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 263. Contains a N6-acetyllysine at position 273. 98DF6E78EAF3BBC1 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 hnrpd-sfn 1 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 direct interaction direct interaction 1A 14-3-3sigma is a p37 AUF1-interacting protein. (A) Recombinant His-tagged p37 protein was purified from E. coli by NTA resin and mixed with whole-cell HeLa lysate. His-p37 AUF1 was recovered by NTA resin chromatography, proteins resolved by SDS�PAGE, and visualized by silver stain. The 30 kDa band (arrow) was excised and sequenced by mass spectrometry. AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation the His-p37 recovery assay suggested that only the sigma isoform, but not the g or b/z isoforms, of 14-3-3 binds to p37 AUF1. hnrpd-sfn-1 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 3A 14-3-3sigma interacts primarily with the p37 isoform of AUF1. AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation there was little detectable interaction with the other three isoforms of AUF1, p40, p42 or p45 (Figure 3A). sfn-hnrpd 3 6 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3B The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45 (Figure 3B). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45. sfn-hnrpd-1 3 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association 4 A 20 amino-acid sequence in the CTD of p37 AUF1 is critical for interaction with 14-3-3s. AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation p37 AUF1 was used in the experiment. sfn-hnrpd-2 3 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) physical association physical association 3B The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45 (Figure 3B). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45. sfn-hnrpd-3 3 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 2A GST-14-3-3 was recovered by glutathione Sepharose-GSH resin chromatography, and the association of His-p37 AUF1 was examined by immunoblot analysis using anti-AUF1 antibody. In vitro binding analysis revealed that p37 AUF1 interacts with 14-3-3 directly, and does so in a dose-dependent manner (Figure 2A). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation hnrpd-sfn-2 3 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 2B Under identical binding conditions, recombinant purified p37 AUF1 was found to interact strongly with 14-3-3s, to a lesser extent with 14-3-3Z, but not with 14-3-3z (Figure 2B). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation hnrpd-ywhah-3 3 7 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 2B Under identical binding conditions, recombinant purified p37 AUF1 was found to interact strongly with 14-3-3s, to a lesser extent with 14-3-3Z, but not with 14-3-3z (Figure 2B). AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation hnrpd-sfn-3 3 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 direct interaction direct interaction 1C the His-p37 recovery assay suggested that only the sigma isoform, but not the g or b/z isoforms, of 14-3-3 binds to p37 AUF1 (Figure 1C) AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation