IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. GFP-Rab21 is detected with an anti-tag western blot additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. The MDA-MB-231 cells were surface labeled with cleavable biotin and lysed immediately or allowed to internalize cell surface proteins for 15 min. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions human-saos-2 Homo sapiens SAOS-2 cell line established from primary osteogenic sarcoma saos-2 Homo sapiens SAOS-2 cell line established from primary osteogenic sarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J. Cell Biol. (0021-9525) 2006 imex curation Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pellinen T., Arjonen A., Vuoriluoto K., Kallio K., Fransen JA., Ivaska J. Synapse - Interactions of proteins with an established role in the presynapse. additional information about the origin of the cDNA constructs has been supplied by the authors. johanna.ivaska@vtt.fi Accepted 2010-MAY-8 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. mouse embryonic cDNA library J. Cell Biol. (0021-9525) 2006 orchard Only protein-protein interactions imex curation ita2_human Integrin alpha-2 Platelet membrane glycoprotein Ia Collagen receptor VLA-2 subunit alpha CD49 antigen-like family member B ITGA2 CD49B protein protein human Homo sapiens Human MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFPKQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQAHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKKGILGQHQFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKYSQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS DIP protein P17301 original sequence version: 108 DIP protein P17301 original sequence version: 186 7E1B7ED968A94070 integrin-a2-5_human chimeric integrin containing the extracellular domain of alpha2-integrin fused to the C terminal domain of alpha5 protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt ita11_human Integrin alpha-11 ITGA11 MSTP018 protein protein human Homo sapiens Human MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGAPLETNGYQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVLGYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNETSFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKNHGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQAMRGQQIGSYFGSEITSVDIDGDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNARFGSSIASVRDLNQDSYNDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATGLQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCKRSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAVLLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTTLRVSVPFWNGCNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFFRAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFTRSSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLLKLRDFLTDEANTSCNIWGNSTEYRPTPVEEDLRRAPQLNHSNSDVVSINCNIRLVPNQEINFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQVPIWIIVGSTLGGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE BFD95E57ED5D5849 rab21_mouse Ras-related protein Rab-21 Rab21 Rab-12 protein protein mouse Mus musculus Mouse MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG 7FB005C28E8D6954 rab21_human Ras-related protein Rab-21 RAB21 KIAA0118 protein protein human Homo sapiens Human MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG DIP protein Q9UL25 original sequence version: 63 73CA2C127F0CBFD6 integrin-a2-1_human chimeric integrin containing the extracellular domain of alpha2-integrin fused to the C terminal domain of alpha1 protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt itb1_human Integrin beta-1 Fibronectin receptor subunit beta VLA-4 subunit beta ITGB1 FNRB MDF2 MSK12 Glycoprotein IIa protein protein human Homo sapiens Human MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK DIP protein P05556 original sequence version: 139 DIP protein P05556-1 original sequence version: 143 DIP protein P05556 original sequence version: 154 DIP protein P05556 original sequence version: 167 DE35979C1625578C rab5a_human Ras-related protein Rab-5A RAB5A RAB5 protein protein human Homo sapiens Human MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN DIP protein P20339 original sequence version: 100 EC03DDF96BBEF821 itga2-rab21-1 3 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait c-terminus cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association itga2-rab21-2 1 14 unspecified role unspecified role bait bait region GFP tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey physical association physical association fig. 1. A GFP-tagged Rab21 coprecipitated with α2β1-integrin specific antibody against integrin alpha2 for the western blot The authors said that GFP-tagged Rab21 coprecipitated with alpa2 beta1-integrin but they used only antibodies against alpha2-integrin for the western blot P35282 transfection itga2_a1-rab21-1 8 14 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 14:39:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln76leu' Tue Jun 30 17:46:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln76Leu' 16 unspecified role unspecified role bait bait physical association physical association fig. 1. B Rab21 coprecipitated with chimeric integrins containing the extracellular domain of α2-integrin fused to the cytoplasmic domains of either α1- or α5-integrin specific antibody against integrin alpha2 for the immunoprecipitation EBI-2624041; P35282 transfection itgb1-rab21-1 8 14 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 18:37:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln76leu' Tue Jun 30 16:18:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln76Leu' 17 unspecified role unspecified role bait bait physical association physical association fig. 1. B Rab21 coprecipitated with chimeric integrins containing the extracellular domain of α2-integrin fused to the cytoplasmic domains of either α1- or α5-integrin (Fig. 1 BFigure 1.) and endogenous integrins that were immunoprecipitated with antibodies against α1, α2, α5, α6, and β1 subunits specific antibody against integrin beta1 for the immunoprecipitation P35282 transfection itga2_a5-rab21-1 8 14 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 16:18:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln76leu' Tue Jun 30 17:48:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln76Leu' 12 unspecified role unspecified role bait bait physical association physical association fig. 1. B Rab21 coprecipitated with chimeric integrins containing the extracellular domain of α2-integrin fused to the cytoplasmic domains of either α1- or α5-integrin specific antibody against integrin alpha2 for the immunoprecipitation EBI-2624056; P35282 transfection itgb1-rab21-2 6 14 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P35282:p.Thr31Asn Rab21GDP mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 15:45:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr31asn' Tue Jun 30 18:40:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr31Asn' range C-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:58:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln76leu' Tue Jun 30 17:25:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln76Leu' 17 unspecified role unspecified role bait bait physical association physical association fig. 1. C and supplementary table S1 Rab21 coprecipitated with chimeric integrins containing the extracellular domain of α2-integrin fused to the cytoplasmic domains of either α1- or α5-integrin (Fig. 1 BFigure 1.) and endogenous integrins that were immunoprecipitated with antibodies against α1, α2, α5, α6, and β1 subunits specific antibody against integrin beta1 for the immunoprecipitation P35282 transfection The mutant Rab21c-del which is composed of the residues 1 to 144 of the full length Rab21 is weakly interacting with interactin beta. The residues 95 to 144 seem to be sufficient to bind. itga2-rab21-3 6 14 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 17:54:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln76leu' Tue Jun 30 18:59:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln76Leu' P35282:p.Thr31Asn Rab21GDP mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 19:50:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr31asn' Tue Jun 30 18:52:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr31Asn' range C-terminal sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait physical association physical association Supplementary table S1 Rab21 coprecipitated with chimeric integrins containing the extracellular domain of α2-integrin fused to the cytoplasmic domains of either α1- or α5-integrin (Fig. 1 BFigure 1.) and endogenous integrins that were immunoprecipitated with antibodies against α1, α2, α5, α6, and β1 subunits specific antibody against integrin alpha2 for the immunoprecipitation P35282 transfection The mutant Rab21c-del which is composed of the residues 1 to 144 of the full length Rab21 is weakly interacting with interactin alpha. The residues 95 to 144 seem to be sufficient to bind. itga11-rab21-1 10 14 unspecified role unspecified role prey prey c-terminus COOH terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait c-terminus C-terminal construct sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 58 60 physical association physical association fig. 1. D itga2-rab21-4 5 14 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region GFP tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P17301:p.Lys1160_Arg1161delinsAlaAla lys1160ala_arg1161ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain KR AA Thu Jul 07 12:16:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was lys1160ala_arg1161aa Fri Jul 22 10:50:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1160ala,arg1161ala' Wed May 02 17:49:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg1160-1161ala_ala' Tue Jun 30 17:04:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1160_Arg1161delinsAlaAla' P17301:p.Lys1162Pro lys1162pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K P Wed May 02 15:32:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1162pro' Tue Jun 30 20:25:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1162Pro' P17301:p.[Lys1160_Arg1161delinsAlaAla;Glu1164_Lys1165delinsAlaAla] lys1160ala_arg1161ala_glu1164ala_lys1165ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain EK AA certain certain sequence position certain certain certain sequence position certain KR AA Thu Jul 07 12:17:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was krkyek1161_1165aakya Fri Jul 22 11:03:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1160ala,arg1161ala,glu1164ala,lys1165ala' Wed May 02 18:40:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg1160-1161ala_ala,glu_lys1164-1165ala_ala' Tue Jun 30 16:48:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys1160_Arg1161delinsAlaAla;Glu1164_Lys1165delinsAlaAla]' physical association physical association fig. 1. E P17301; P35282 transfection rab21-itgb1-3 4 15 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association fig. 1. F and Fig. 3. A Finally, endogenous β1-integrins readily associated with endogenous Rab21 specific antibody against Rab21 for the immunoprecipitation and specific antibody against integrin beta1 for the western blot beta integrin associate with Rab21 mainly after internalization rab5-itgb1-1 4 18 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association fig. 1. F and Fig. 3. A Finally, endogenous β1-integrins readily associated with endogenous Rab21 and to some extent Rab5 proteins in vivo specific antibody against Rab5 for the immunoprecipitation and specific antibody against integrin beta1 for the western blot beta integrin associate with Rab5 mainly after internalization rab21-itga2-5 2 14 unspecified role unspecified role neutral component neutral component region GFP tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P35282:p.Gln76Leu Rab21GTP mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:28:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln76leu' Tue Jun 30 18:28:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln76Leu' P35282:p.Thr31Asn Rab21GDP mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 16:27:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr31asn' Tue Jun 30 18:50:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr31Asn' 11 unspecified role unspecified role neutral component neutral component physical association physical association fig. 3. D P35282 transfection GFP-Rab21 cofractionned with alpha 2 integrin in fractions 3 to 9. The mutant gln76leu-Rab21 cofractionned with alpha 2 integrin in fractions 5 to 11 (denser fractions) and thr31asn-Rab21 cofractionned with alpha 2 integrin in fractions 4 to 8. itgb1-rab21-4 7 14 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait physical association physical association Fig. 5. A specific antibody against integrin beta for the immunoprecipitation and P35282 transfection itga2-rab21-6 9 14 unspecified role unspecified role prey prey region Rluc tagged renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait n-terminal GFP tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association fig. 5. A P35282; P17301 transfection itga2-rab21-7 10 14 unspecified role unspecified role prey prey c-terminus COOH terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait c-terminus cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P17301:p.Lys1162Pro lys1162pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K P Wed May 02 16:27:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1162pro' Tue Jun 30 19:46:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1162Pro' P17301:p.Lys1160_Arg1161delinsAlaAla lys1160ala_arg1161ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain KR AA Thu Jul 07 12:16:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was lys1160ala_arg1161al Fri Jul 22 11:15:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1160ala,arg1161ala' Wed May 02 19:31:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg1160-1161ala_ala' Tue Jun 30 20:02:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1160_Arg1161delinsAlaAla' P17301:p.[Phe1159_Lys1160delinsAlaAla;Lys1162Ala] phe1159ala_lys1160ala_lys1162ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain FK AA Thu Jul 07 12:16:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was fkrk1159_1162aara Fri Jul 22 11:02:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe1159ala,lys1160ala,lys1162ala' Wed May 02 19:36:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_lys1159-1160ala_ala,lys1162ala' Tue Jun 30 16:08:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe1159_Lys1160delinsAlaAla;Lys1162Ala]' undefined mutation lys1160ala_arg1161ala_glu1164ala_lys1165ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:49:03 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'krkyek1160_1165aakya' 94 92 physical association physical association fig. 1. D