IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CASK inhibits ECV304 cell growth and interacts with Id1. CASK inhibits ECV304 cell growth and interacts with Id1. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn 10-APR-2007: Contacted by JYOTI. Human fetal brain cDNA human-ecv304 Human umbilical cord, endothelial ECV304 ecv304 Human umbilical cord, endothelial ECV304 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn Accepted 2007-APR-28 by DAVET. 10-APR-2007: Contacted by JYOTI. Human fetal brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2005 CASK inhibits ECV304 cell growth and interacts with Id1. CASK inhibits ECV304 cell growth and interacts with Id1. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn 10-APR-2007: Contacted by JYOTI. Human fetal brain cDNA human-ecv304 Human umbilical cord, endothelial ECV304 ecv304 Human umbilical cord, endothelial ECV304 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn Accepted 2007-APR-28 by DAVET. 10-APR-2007: Contacted by JYOTI. Human fetal brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2005 CASK inhibits ECV304 cell growth and interacts with Id1. CASK inhibits ECV304 cell growth and interacts with Id1. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn 10-APR-2007: Contacted by JYOTI. Human fetal brain cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Qi J., Su Y., Sun R., Zhang F., Luo X., Yang Z., Luo X. Synapse - Interactions of proteins with an established role in the presynapse. luoxd@mail.tmmu.com.cn Accepted 2007-APR-28 by DAVET. 10-APR-2007: Contacted by JYOTI. Human fetal brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2005 p41134-2 DNA-binding protein inhibitor ID-1 ID1 BHLHB24 ID Class B basic helix-loop-helix protein 24 Inhibitor of DNA binding 1 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEVRSRSDH DA265F6900663BC2 id1_human DNA-binding protein inhibitor ID-1 ID1 ID Inhibitor of DNA binding 1 BHLHB24 Class B basic helix-loop-helix protein 24 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR DIP protein P41134 original sequence version: 156 DIP protein P41134 original sequence version: 115 480287384B667161 p41134-1 DNA-binding protein inhibitor ID-1 ID1 BHLHB24 ID Class B basic helix-loop-helix protein 24 Inhibitor of DNA binding 1 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR 480287384B667161 cskp_human Peripheral plasma membrane protein CASK CASK LIN2 Calcium/calmodulin-dependent serine protein kinase Protein lin-2 homolog protein protein human Homo sapiens Human MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 6C02008CE52728BA cask-id1-1 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association To explore the molecular mechanism, we identified a novel CASK-interacting protein, inhibitor of differentiation 1 (Id1) with a yeast two-hybrid screening. cask-id1-2 2 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. 2 cask-id1-3 2 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. 2 cask-id1-4 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association The constructed fusion proteins in mammalian two-hybrid protein�protein interaction system were used for analysis of the binding activities between the full length of CASK and two isoforms of Id1 and Id1prime. 3 cask-id1-5 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association The constructed fusion proteins in mammalian two-hybrid protein�protein interaction system were used for analysis of the binding activities between the full length of CASK and two isoforms of Id1 and Id1prime. 3