IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mol. Membr. Biol. (0968-7688) 2004 Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. rat-brain Rattus norvegicus brain brain Brain [cerebrum] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip polyclonal western polyclonal antibody western blot polyclonal western Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Membr. Biol. (0968-7688) 2004 Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mol. Membr. Biol. (0968-7688) 2004 Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip polyclonal western polyclonal antibody western blot polyclonal western Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Membr. Biol. (0968-7688) 2004 Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mol. Membr. Biol. (0968-7688) 2004 Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Membr. Biol. (0968-7688) 2004 Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mol. Membr. Biol. (0968-7688) 2004 Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Membr. Biol. (0968-7688) 2004 Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mutually exclusive interactions of EHD1 with GS32 and syndapin II. Mol. Membr. Biol. (0968-7688) 2004 Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Xu Y., Shi H., Wei S., Wong SH., Hong W. Synapse - Interactions of proteins with an established role in the presynapse. Mol. Membr. Biol. (0968-7688) 2004 snp29_rat Synaptosomal-associated protein 29 Vesicle-membrane fusion protein SNAP-29 Soluble 29 kDa NSF attachment protein Golgi SNARE of 32 kDa Snap29 protein protein rat Rattus norvegicus (Rat) Rat MSGYPKSYNPFDDDVEDEDTRPAPWKDARDLPDGPDPPIDRQQYLRQEVLRGPSATAASTSRSLFLMYESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPKNSSLRAYHQKIDSNLDELSVGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL 9B9BC1A351CB1A3C ehd1_rat EH domain-containing protein 1 Ehd1 protein protein rat Rattus norvegicus (Rat) Rat MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQAVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKRRHE 35502055BC6164F7 ehd1_human EH domain-containing protein 1 Testilin CDABP0131 EHD1 PAST PAST1 PAST homolog 1 protein protein human Homo sapiens Human MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE 3330218772A26CE4 ehd4_mouse EH domain-containing protein 4 Ehd4 Past2 PAST homolog 2 protein protein mouse Mus musculus Mouse MFSWMGRQAGGRERSGGMDAVQTVTGGLRSLYQRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISIIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPNMFGKENKKRELIYRLPEIYVQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLTNKISSLMGLISQEEMNMPTQMVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPNSLPPHLVPPSHRKSLPKAD D34C28F046D740E1 pacn2_rat Protein kinase C and casein kinase substrate in neurons 2 protein Synaptic dynamin-associated protein II Syndapin-II Pacsin2 Syndapin-2 protein protein rat Rattus norvegicus (Rat) Rat MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWMAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVDAAKKAHHTACKEEKLAVSREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKALKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKGIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEDEEWSADLNRTLSRREKKKAADGVTLTGINQTGDQSGQNKPSSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSVSEKEDIKAKNVSSYEKTQNYPADWSDDESNNPFSSTDANGDSNPFDEDTTSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAIQ B2975012EF0FDF56 snap29-ehd1-1 5 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association snap29-ehd1 3 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association snap29-ehd1-3 1 7 unspecified role unspecified role bait bait rat-brain Rattus norvegicus brain brain Brain [cerebrum] 6 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Q641Z6 is a homolgue of mammalian EHD1 protein. ehd1-syndapin 4 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey physical association physical association snap29-ehd1-5 5 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association ehd1-syndapin-3 5 9 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sh3-dom npf-repeat binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association syndapin-ehd1-3 5 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association ehd1-syndapin-4 5 10 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association ehd1-syndapin-6 1 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Q641Z6 is a rat EHD1 protein ortholog. ehd1-snap29-3 2 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association