IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. J. Biol. Chem. (0021-9258) 2004 Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2004 The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. J. Biol. Chem. (0021-9258) 2004 Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2004 The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites. J. Biol. Chem. (0021-9258) 2004 Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mattera R., Puertollano R., Smith WJ., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2004 ts101_human Tumor susceptibility gene 101 protein TSG101 ESCRT-I complex subunit TSG101 protein protein human Homo sapiens Human MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY ADD6912FC22DF162 gga1_human ADP-ribosylation factor-binding protein GGA1 Golgi-localized, gamma ear-containing, ARF-binding protein 1 Gamma-adaptin-related protein 1 GGA1 protein protein human Homo sapiens Human MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDELMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL B0B6F089FA0F7DD5 rabe1_human Rab GTPase-binding effector protein 1 Rabaptin-5 Rabaptin-5alpha Rabaptin-4 Renal carcinoma antigen NY-REN-17 RABEP1 RABPT5 RABPT5A RAB5EP protein protein human Homo sapiens Human MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQNAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMKETVRDYEHQFHLRLEQERTQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKVKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVCALTQEESSAQLSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET DIP protein Q15276 original sequence version: 59 CAAF91638B8ED516 ap1g1_human AP-1 complex subunit gamma-1 Adaptor protein complex AP-1 subunit gamma-1 Golgi adaptor HA1/AP1 adaptin subunit gamma-1 Gamma1-adaptin Clathrin assembly protein complex 1 gamma-1 large chain AP1G1 ADTG CLAPG1 Adaptor-related protein complex 1 subunit gamma-1 protein protein human Homo sapiens Human MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ 42EF40223DFBA5E9 ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC 33011162F1C48BB1 arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK DIP protein P84077 original sequence version: 122 DIP protein P84077 original sequence version: 56 DIP protein P84077 original sequence version: 89 AAC773D4A60186B6 rabx5_bovin Rab5 GDP/GTP exchange factor Rabex-5 RABGEF1 RABEX5 protein protein bovin Bos taurus (Bovine) Bovine MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGAKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEAMHYKRDLSIEEQSECTQDFYQNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESENWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIRPPNQSVAAIDSENVENDKLPPPLQPQVYAG DIP protein O18973 original sequence version: 39 98828A4344B15EE7 gga1-arf1-1 2 9 unspecified role unspecified role bait bait P84077:p.Gln71Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 14:36:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln71leu' Tue Jun 30 20:10:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln71Leu' P84077:p.Thr32Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T N Wed May 02 15:55:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr32asn' Tue Jun 30 18:14:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr32Asn' 5 unspecified role unspecified role prey prey Q9UJY5:p.[Leu182Ala;Asn194Ala;Ile197Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain I A Wed May 02 15:42:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu182ala,asn194ala,ile197ala' Tue Jun 30 16:35:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu182Ala;Asn194Ala;Ile197Ala]' gat domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association constitutively active mutant of Arf1 is used (Q71L) for interaction. No interaction is detected with Arf1 T31N. gga1-rabep1-3 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association GAT domain of GGA1 is used (148-314) Each of the following mutations the F264A, A267D and L277A within the GGA1-GAT domain impairs the interaction with Rabaptin-5. interaction is shown with Rabaptin-5 full-length, 551-661 fragment and 551-862 fragment. gga1-tsg101-1 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Each of the following mutations the I197A, L277A and L182A within the GGA1-VHS-GAT fragment impairs the interaction with TSG101. VHS-GAT fragment of GGA1 is used (5-314) gga1-ubc-1 2 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Each of the following mutations the R560E, A267D and L277A within the GGA1-VHS-GAT fragment impairs the interaction with Ubiquitin. VHS-GAT fragment of GGA1 is used (5-314) gga1-ubc-2 1 5 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) physical association physical association Each of the following mutations the R560E, A267D and L277A within the GGA1-VHS-GAT fragment impairs the interaction with Ubiquitin. VHS-GAT fragment of GGA1 is used (5-314) GGA1-VHS-GAT fragment is GST tag Rabaptin-5 (551-862) competes with GGA1 binding to Ubiquitin gga1-ubc-3 3 8 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association revisit when protein editor is in place GGA1 VHS-GAT fragment (5-314) is used GGA1 VHS-GAT fragment has GST tag Ubiquitin has a His tag gga1-rabgef1-1 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association rabex-1 is from bovin brain cytosol rabgef1-ap1g1-1 2 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey physical association physical association adaptin gamma 1 ear domain is used (707-822) adaptin gamma 1 ear is GST tagged revisit when feature and tag editor is in place