IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. J. Biol. Chem. (0021-9258) 2004 Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. J. Biol. Chem. (0021-9258) 2004 Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. J. Biol. Chem. (0021-9258) 2004 Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. J. Biol. Chem. (0021-9258) 2004 Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins. J. Biol. Chem. (0021-9258) 2004 Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Leonoudakis D., Conti LR., Anderson S., Radeke CM., McGuire LM., Adams ME., Froehner SC., Yates JR., Vandenberg CA. Synapse - Interactions of proteins with an established role in the presynapse. Detergent solubilized whole rat brain extract was used for affinity chromatography using a GST tagged bait (kir2.2). The interactors were eluted using a competitor bait peptide (ERPYRRESEI for kir2.2). Eluates were dried and analyzed by mass spectrometry after protein digestion. A control experiment using a Kir2.2 fragment with a 3 amino-acids deletion at the c-terminus was used instead. Only the interactors which were not found in the control experiment are reported here. table 1 vandenbe@lifesci.ucsb.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 dlg2_rat Disks large homolog 2 Dlg2 Postsynaptic density protein PSD-93 Channel-associated protein of synapse-110 Dlgh2 protein protein rat Rattus norvegicus (Rat) Rat MFFACYCALRTNVKKYRYQDEDGPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPYPHYHLGLLPDSDMTSHSQHSTATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVILDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGDDGYGTKTLRGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL F8D414A8B9CF5B09 kcnj2_mouse Inward rectifier potassium channel 2 Potassium channel, inwardly rectifying subfamily J member 2 Inward rectifier K(+) channel Kir2.1 Kcnj2 Irk1 protein protein mouse Mus musculus Mouse MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDTSKVSKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRPLRRESEI 5B4219F979BBA41C lin7a_rat Protein lin-7 homolog A Mammalian lin-seven protein 1 Vertebrate lin-7 homolog 1 Lin7a Mals1 Veli1 protein protein rat Rattus norvegicus (Rat) Rat MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQPQQNHMS C37984D803B90A63 dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein P31016 original sequence version: 86 DIP protein P31016-1 original sequence version: 148 7922D4E8E0F9AD85 cskp_rat Peripheral plasma membrane protein CASK Calcium/calmodulin-dependent serine protein kinase Cask protein protein rat Rattus norvegicus (Rat) Rat MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHHVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNADLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPERFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFPPFVVFIAAPTITPGLNEDESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 3694A9A44AC29629 kcj12_rat ATP-sensitive inward rectifier potassium channel 12 Potassium channel, inwardly rectifying subfamily J member 12 Inward rectifier K(+) channel Kir2.2 Kcnj12 Irk2 protein protein rat Rattus norvegicus (Rat) Rat MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGRTPCVLQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMGRPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEVATDRDGRSPQPEHDFDRLQASSGALERPYRRESEI 6FA100FEB6066677 kcj10_rat ATP-sensitive inward rectifier potassium channel 10 Potassium channel, inwardly rectifying subfamily J member 10 ATP-sensitive inward rectifier potassium channel KAB-2 Inward rectifier K(+) channel Kir4.1 BIR10 Brain-specific inwardly rectifying K(+) channel 1 Kcnj10 Kab-2 protein protein rat Rattus norvegicus (Rat) Rat MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV 77B3671907B68CB2 apba1_rat Amyloid-beta A4 precursor protein-binding family A member 1 Neuron-specific X11 protein Neuronal Munc18-1-interacting protein 1 Adapter protein X11alpha Apba1 Mint1 X11 protein protein rat Rattus norvegicus (Rat) Rat MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPSPPPPAGHAPEDHRAHPAPPPPPPPQEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYAVQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRAEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSITPLHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI 57F6EEA458376CAD lin7c_rat Protein lin-7 homolog C Mammalian lin-seven protein 3 Vertebrate lin-7 homolog 3 Lin7c Mals3 Veli3 protein protein rat Rattus norvegicus (Rat) Rat MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT 7410FBFA3BD24F45 dlg3_rat Disks large homolog 3 Dlg3 Dlgh3 Synapse-associated protein 102 PSD-95/SAP90-related protein 1 protein protein rat Rattus norvegicus (Rat) Rat MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKNTPKLNGSGPSWWPECTCTNRDWYEQASPAPLLVNPEALEPSLSVNGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPETIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVTYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIFDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL 34DA9C46C7BB96DB kcnj4_human Inward rectifier potassium channel 4 Potassium channel, inwardly rectifying subfamily J member 4 Inward rectifier K(+) channel Kir2.3 Hippocampal inward rectifier HIRK2 HRK1 IRK3 KCNJ4 protein protein human Homo sapiens Human MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI 893F03365273E8BE dmd_rat Dystrophin Dmd protein protein rat Rattus norvegicus (Rat) Rat MLWWEEVEDCYEREDVQKKTFTKWINAQFSKFGKQHIDNLFSDLQDGKRLLDLLEGLTGQKLPKEKGSTRVHALNNVNKALQVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKTIMAGLQQTNSEKILLSWVRESTRNYPQVNVLNFTSSWSDGLALNALIHSHRPDLFDWNSVVSQQSATQRLEHAFNIAKCQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQVSIEAIREVEMLPRPSKVTREEHFQLHHQMHYSQQITVSLAQGYEQTSSSPKPRFKSYAFTQAAYVATSDSSQSPYPSQHLEAPGSKSFGSSLIETEVNLDSYQTALEEVLSWLLSAEDTLRAQGEISKDVEEVKEQFHAHEGFMMDLTSHQGLVGNVLQLGSRLVGKGKLTEDEETEVQEQMNLLNSRWECLRVASMEKQSNLHKVLMDLQNQKLKELDDWLTKTEERTKKMEEEPLGPDLEDLKCQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANICKWTEDRWILLQDILLKWQRFTEEQCLFSKWLSEKEDAMKNIQTSGFEDQNEMVSSLQNISALKIDLEKKKQSMEKLSSLNQDLLSALKNKSVTQKMEMWMENFAQRWDNLTQKLEKSSAQISQAVTTTQPSLTQTTVMETVTMVTTREQIMVKHAQEELPPPPPQKKRQITVDSEIRKRLDVDITELHSWITRSEAVLQSSEFAVYRKEGNISDLKEKVNAIAREKAEKFRKLQDASRSAQALVEQMVNEGVNAESIRQASEQLNSRWTEFCQLLSERVNWLEYQNNIITFYNQLQQLEQMTTTAENLLKTQPTTLSEPTAIKSQLKICKDEVNRLSALQPQIERLKIQSLTLKEKGQGPMFLDADFVAFTNHFNYVFDGVRAREKELQTIFDTLPPMRYQETMSSIRTWIQQSENKLSIPHLSVTEYEIMEERLGKLQALQSSLKEQQNGFNYLNATVKEIAKKAPSEISQKYQSEFEEVEGRWKKLSTQLVEHCQKLEEHMNKLRKFQNHKKTLQKWMAEVDVFLKEEWPALGDAEILKKQLKQCRLLVGDIQTIQPSLNSVNEGGQKIKSEAEFEFASRLEKELKELNTQWDHICRQVYTRKEALKAGLDKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQTAVEEMKRAKEEALQKEAKVKLLTETVNSVISQAPPAAQEALKKELETLTTNYQWLCTRLNGKCKTLEEVWACWHELLSYLEKANKWLNEVELKLKATENVPAGAEEITEVLESLENLMHHSEENPNQIRLLAQTLTDGGVMDELINEELETFNSRWRELHEEAVRKQKLLEQSIQSAQEIEKSLHLIQESLEFIDKQLAAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKDANQRVLSQIDVAQKKLQDVSIKFRLFQKPANFEQRLEESKMILDEVKMHLPALETKSVEQEVVQSQLSHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEMNVLTEWLAATDTELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKAHLKSVTELGDSLKTVLGKKETLVEDKLTLLNSNWIAVTSRVEEWLNLLLEYQKHMESFDQNVEHITKWIIHTDELLDESEKRKPQQKEDILKRLKAEMNDIRPKVDATRDQAAKLMANRGDYCRKIVEPQISELNRRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKEEDFNKDMSEDNEGTVNELLQRGDNLQQRITDERKREEIKLKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKSQADDLLKCLDEIEKKLASLPEPRDERKIKEIDRELQKKKEELNAVRRQAESLSENGAAMAVEPTQIQLSKRWREIESNFAQFRRLNFAQIHTLHEETMVVTTEDMPLDVSYVPSTYLTEISHILQALSEVEQLLNAPELNAKDFEDLFKQEESLKNIKENLQQISGRIDVIHKKKTAALQSATPMERVKLQEAVSQMDFHWEKLNRMYKERQGRFDRSVEKWRHFHYDMKVFNQWLNDVEQFFKKTQNPENWEHAKYKWYLKELQDGIGQRQAVVRTLNATGEEIIQQSSKTDANILQEKLGSLSLRWHEVCKELAERRKRVEEQKNVFSEFQRDLNEFVSWLEEADNIATTPPGDEEQLKEKLEQVKLLTEELPLRQGILKQLNETGGAVLVSAPIRPEEQDKLEKKLKQTNLQWIKVSRALPEKQGELEVHIKDFRQFEEQLDHLLLWLSPIRNQLEIYNQPSQPGPFDLKETEVTVQAKQPDVERLLSKGQHLYKEKPSTQPVKRKLEDLRSEWEAVNHLLWELRTKQPDRAPGLSTTGASASQTVTVVTQPVDTKETVISKLEMPSSLLLEVPALADFNRAWTELTDWLSLLDRVIKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQIQWDEVQEQLQNRRQQLNEMLKDSTQWLEAKEEAEQVIGQARGKLDSWKEGPHTMDAIQKKITETKQLAKDLRQRQINVDVANDLALKLLRDYSADDTRKVHMITENINTSWGNILKRVSEREAALEETQRLLQQFPLDLEKFLAWITEAETTANVLQDASRKEKLLEDSRGVRELMKPWQDLQGEIEAHTDIYHNLDENGQKILRSLEGSDEAPLLQRRLDNMNFKWSELRKKSLNIRSHLEVSSDQWKRLHLSLQELLVWLQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWDKLNLHSADWQRKIDEALERLQELQEAADELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVNHVNDLAHHLTTLGIQLSPYNLSILEDLNTRWRLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSESMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNAPGKPMREDTM 50526FA367B87FAB dlg1_rat Disks large homolog 1 Dlg1 Synapse-associated protein 97 Dlgh1 protein protein rat Rattus norvegicus (Rat) Rat MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPPVEKYRYQDEEVLPSERISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIKPTEAVPPSSPIVPVTPALPVPAESPVVLPSTPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRKAFRKNHEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKAAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSYLGQTPASPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLRETMMNSSVSSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEKL DIP protein Q62696 original sequence version: 129 DIP protein Q62696 original sequence version: 155 18CEBD31DD0CAF8B kcnj12-dlg1-1 2 10 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 14 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 8 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 6 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 15 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 9 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 18 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-704594]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-704594]363-428 pdz binding motif required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-704596]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-704596]425-428 ecoli Escherichia coli (strain K12) association association rat Pals2 (Vam-1) and actin-binding LIM protein-1 (ab-LIM) were also identified Add rat Pals2 (Vam-1) and actin-binding LIM protein-1 (ab-LIM) when available kcnj12-dlg1-2 1 13 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 15 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 10 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 14 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 8 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 6 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 9 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 18 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 11 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-704689]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-704689]363-428 pdz binding motif required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-704691]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-704691]425-428 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association rat Pals2 (Vam-1), actin-binding LIM protein-1 (ab-LIM), alpha dystrobrevin-1, alpha-dystrobrevin-2 and dystrophins proteins were also identified Add rat Pals2 (Vam-1), actin-binding LIM protein-1 (ab-LIM), alpha dystrobrevin-1 and alpha-dystrobrevin-2 when available kcnj12-dlg1-3 4 13 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 10 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 14 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 8 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 18 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 11 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-704786]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-704786]363-428 pdz binding motif required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-704788]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-704788]425-428 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association rat alpha1-syntrophin and beta1-syntrophin were also identified Add rat alpha1-syntrophin and beta1-syntrophin when available kcnj12-dlg1-4 5 18 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 10 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 14 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 11 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-704887]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-704887]363-428 pdz binding motif required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-704889]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-704889]425-428 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association rat dystrobrevin alpha2, dystrophin Dp427 and beta-syntrophin were also identified Add rat dystrobrevin alpha2, dystrophin Dp427 and beta-syntrophin when available kcnj12-dlg1-5 3 10 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 14 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 18 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 11 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-706102]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-706102]363-428 pdz binding motif required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-706104]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 428-428, sequence length 427 [EBI-706104]425-428 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association rat dystrophins dp71, alpha-dystrobrevin-2 and synthrophins proteins were also identified Add rat dystrophins dp71, alpha-dystrobrevin-2 and synthrophins when available kcnj2-dlg1-6 3 7 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-706116]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 429-429, sequence length 428 [EBI-706116]373-429 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 14 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 18 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] association association kcnj4-dlg1-7 3 10 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-706138]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 446-446, sequence length 445 [EBI-706138]391-446 ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 14 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] association association kcnj4-dlg1-8 3 12 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-706196]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 380-380, sequence length 379 [EBI-706196]330-380 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] physical association physical association Rat dystrophin dp71, alpha-dystrobrevin-2 and synthrophins proteins were also identified Add rat dystrophin dp71, alpha-dystrobrevin-2 and synthrophins proteins when available