IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin. Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Walther K., Diril MK., Jung N., Haucke V. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Walther K., Diril MK., Jung N., Haucke V. Synapse - Interactions of proteins with an established role in the presynapse. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin. Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Walther K., Diril MK., Jung N., Haucke V. Synapse - Interactions of proteins with an established role in the presynapse. mouse-n1e-115 Mus musculus neuroblastoma cells n1e-115 Mouse neuroblastoma imaging technique imaging technique microscopy immunostaining immunostaining Walther K., Diril MK., Jung N., Haucke V. Synapse - Interactions of proteins with an established role in the presynapse. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin. Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Walther K., Diril MK., Jung N., Haucke V. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Walther K., Diril MK., Jung N., Haucke V. Synapse - Interactions of proteins with an established role in the presynapse. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 peptide-wvtf tetrapeptide with the sequence WVTF protein protein in vitro In vitro WVTF AP2 mu2 binding site found in : stonin 1 (mouse, human), stonin 2 (mouse, human), stonin (fugu, zebrafish, xenopus tropicalus), synaptojanin 1 (human)... The more general motif 'WVxF' is also found in : intersectin 2, pacsin/syndapin 1, AAK1, NECAP1 human proteins 69D1B2D310000000 ston1_mouse Stonin-1 Stoned B-like factor Ston1 Sblf Stn1 Salf protein protein mouse Mus musculus Mouse MYSTNPGSWVTFDDDPAFQSSQKRKDFSLETQGVCRPNGLKLTLPTLRDPPSTPSSASSTPLSSPMVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPECSSSSAPTTAGGVGPPLLLTKPDCSPHVSLPSSHSHTQPTPTLGFTEDAGPQRVQSEARQFEYFQDHCAFSNPFWKDEGSASPFPLDSLASRKPFSPKDKEVPIGHKSLTQCSLDYICEKLEHLHSAETQDPLGDLSMQDPYAGDTVSFVPHSLFRSQPRAGWSFMLRIPEKKNMMSSRQWGPIFLKVLPGGILQMYYEKGLEKPFKEFQLDPHCRLSEPKLENFSMAGKIHTVKVEHVSYSEKRKYHAKTEVVHEPEVEQMLKLGSTEHRDFLEFLTTVEEELIKLPATAKPKNKSYEEQEICLDIQDSLWGKVTKEGQLVESAVVTQICCLCFLNGPAECFLALNDRELQKRDECYFEKEPEKKGIAILDYHFHTCVKAEEFEQSRIIKFVPLDACRFELMRFKTSYEAGELPFAVKSVVTVQGAYVELQAFVNMTPAAQGSPHAGALRSCNNIMIHFPVPAQWIKALWTRNLQRQKSLKAKMNRRACLGSLQEPESEPVIQVTVGSAKYESAYRAVVWKIDRLPDKNSSPDQPHCLSYKLELGSDQEVPSDWYPFATVQFSMLEACASRTEVRSLGVESDAQPQKHVCQRACYNIQVEIEKKWIQVDGEDADKTGGCVTQ FC55399706280B81 syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P21707 original sequence version: 71 DIP protein P21707 original sequence version: 76 DIP protein P21707 original sequence version: 141 DIP protein P21707 original sequence version: 112 DIP protein P21707 original sequence version: 145 DIP protein P21707 original sequence version: 160 06CE28F04C97A722 ston2_human Stonin-2 Stoned B STON2 STNB STN2 protein protein human Homo sapiens Human MTTLDHVIATHQSEWVSFNEEPPFPAHSQGGTEEHLPGLSSSPDQSESSSGENHVVDGGSQDHSHSEQDDSSEKMGLISEAASPPGSPEQPPPDLASAISNWVQFEDDTPWASTSPPHQETAETALPLTMPCWTCPSFDSLGRCPLTSESSWTTHSEDTSSPSFGCSYTDLQLINAEEQTSGQASGADSTDNSSSLQEDEEVEMEAISWQASSPAMNGHPAPPVTSARFPSWVTFDDNEVSCPLPPVTSPLKPNTPPSASVIPDVPYNSMGSFKKRDRPKSTLMNFSKVQKLDISSLNRTPSVTEASPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISSTTGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSARSQPRDGWPMMLRIPEKKNIMSSRHWGPIFVKLTDTGYLQLYYEQGLEKPFREFKLEICHEISEPRLQNYDENGRIHSLRIDRVTYKEKKKYQPKPAVAHTAEREQVIKLGTTNYDDFLSFIHAVQDRLMDLPVLSMDLSTVGLNYLEEEITVDVRDEFSGIVSKGDNQILQHHVLTRIHILSFLSGLAECRLGLNDILVKGNEIVLRQDIMPTTTTKWIKLHECRFHGCVDEDVFHNSRVILFNPLDACRFELMRFRTVFAEKTLPFTLRTATSVNGAEVEVQSWLRMSTGFSANRDPLTQVPCENVMIRYPVPSEWVKNFRRESVLGEKSLKAKVNRGASFGSTSVSGSEPVMRVTLGTAKYEHAFNSIVWRINRLPDKNSASGHPHCFFCHLELGSDREVPSRFANHVNVEFSMPTTSASKASVRSISVEDKTDVRKWVNYSAHYSYQVALGSIWLMLPTPFVHPTTLPLLFLLAMLTMFAW 59F5810DEC540CA3 ston2_mouse Stonin-2 Stoned B Ston2 Stnb Stn2 protein protein mouse Mus musculus Mouse MTTLDHVIATHQSEWVSFSEEPLFPTPLEGGTEEHFPGLSSSSERSESSSGENHVVDEGSQDLSHSEQDDSSEKMGLISEAASPPGSPVQPTPDLASAISNWVQFEDDTPWSSTSPPHKETALTLTMPCWTCPSFDSLRRCPLTSESSWTTHSEDTSSPSVAPSYTDLQLINTEEQASGRASGTDSTDNSSSLQEDEEVEMEAISWWAGSPAMNGHPAAPPVTTARFPSWVTFEDNEVGCPSPPVPSPKKPNTPSAATAAPDVPFNSTGSFKRDRPKSTLMNLPKVQKLDISSLNRPPSVIEAPPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSVSSTTGKSQRDSLIVVYQDAISFDDSGKSQPHPDAIEKLKQLQIDDPDPVGNTALPDDDPTASVELDAPSPASALSQPRDGWPMMLRIPEKKNIMSSRHWGPIYIKLTASGYLQLYYEQGLEKPFREFKLEICHEVSEPRLQNYDENGRIHSLRIDRVTYKEKKKYQPKPAVAHAAEREQVIKLGTTNYDDFRSFIHAVQDRLMDLPVLSMDLSTVGLNYLEEEITVDVRDEFSGTVGKGDNQILQHHVLTRIHILSFLSGLAECRLGLNDILIKGNEIVSRQDIMPTTTTKWIKLHECRFHGCVDEDVFNSSRVILFNPLDACRFELMRFRTVFAEKTLPFTLRTAASINGAEVEVQSWLRMSPGFSSNRDPLTQVPCENVMVRYPVPSEWVKNFRRDSVLGEKSLKAKVNRGASFGSAGASGSEPVMRVTLGTAKYEHAFNSIVWRINRLPDKNSASGHPHCFFCHLELGSDREVPSRFANYVNVEFSMPTTSASKAAVRSVSVEDKPDVRKWVNYSAHYSYKVEIEQKKSLKPDFEGEDLENPKECGVQ 2CA089956349B96F syt1_human Synaptotagmin-1 Synaptotagmin I p65 SYT1 SYT SVP65 protein protein human Homo sapiens Human MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P21579 original sequence version: 146 467F7C58E411AFA9 ap2m1_rat AP-2 complex subunit mu Adaptor protein complex AP-2 subunit mu AP-2 mu chain Ap2m1 Mu2-adaptin Plasma membrane adaptor AP-2 50 kDa protein Clathrin coat assembly protein AP50 Clathrin coat-associated protein AP50 Clathrin assembly protein complex 2 mu medium chain Adaptor-related protein complex 2 subunit mu protein protein rat Rattus norvegicus (Rat) Rat MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC DIP protein P84092 original sequence version: 91 DIP protein P84092 original sequence version: 42 DIP protein P84092 original sequence version: 82 DIP protein P84092 original sequence version: 67 DIP protein P84092 original sequence version: 92 DIP protein P84092 original sequence version: 105 DIP protein P84092 original sequence version: 110 82803219BA279954 ap2a2_rat AP-2 complex subunit alpha-2 Adaptor protein complex AP-2 subunit alpha-2 Alpha2-adaptin Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit Alpha-adaptin C Clathrin assembly protein complex 2 alpha-C large chain 100 kDa coated vesicle protein C Ap2a2 Adtab Adaptor-related protein complex 2 subunit alpha-2 protein protein rat Rattus norvegicus (Rat) Rat MPAVSKGEGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMGLALHCIANVGSREMAEAFAGEIPKILVAGDTMDSVKQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSASTDLQDYTYYFVPAPWLSVKLLRLLQCYPPPDPAVRGRLTECLETILNKAQEPPKSKKVQHSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEFSHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAQQIVAEMLSYLETADYSIREEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAAKTVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFNLLHSKFHLCSVPTRALLLSTYIKFVNLFPEVKATIQDVLRSDSQLKNADVELQQRAVEYLRLSTVASTDILATVLEEMPPFPERESSILAKLKKKKGPSTVTDLEETKRERSIDVNGGPEPVPASTSAASTPSPSADLLGLGAVPPAPTGPPPSSGGGLLVDVFSDSASAVAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF DIP protein P18484 original sequence version: 80 DIP protein P18484 original sequence version: 124 DIP protein P18484 original sequence version: 134 DIP protein P18484 original sequence version: 140 406428A9BFFB1E53 ap2m1-wvtf-1 1 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P84092:p.Trp421Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A Wed May 02 14:34:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp421ala' Tue Jun 30 19:14:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp421Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trp1ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A phe4ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F A ecoli Escherichia coli (strain K12) physical association physical association the 158-435 fragment of human, mouse and rat mu2 adaptin have the same protein sequence. ap2m1-wvtf-2 1 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trp1ala,phe4ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain F A ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey in vitro In vitro physical association physical association ap2a2-wvtf-1 1 11 unspecified role unspecified role prey prey in vitro In vitro 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trp1ala phe4ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain F A ecoli Escherichia coli (strain K12) physical association physical association ap2m1-stn2-1 3 10 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Stonin 2 WVTF motif is sufficient for AP2 mu2 binding ap2a2-stn2-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association stonin 2 WVTF motif is sufficient for AP2 alpha c binding ap2m1-salf-1 3 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey 35s radiolabel binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association ap2m1-stn2-2 1 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association stn2-syt1-1 2 9 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization