IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification and characterization of proteins that selectively interact with isoforms of the mRNA binding protein AUF1 (hnRNP D). Identification and characterization of proteins that selectively interact with isoforms of the mRNA binding protein AUF1 (hnRNP D). Biol. Chem. (1431-6730) 2003 Moraes KC., Quaresma AJ., Maehnss K., Kobarg J. Synapse - Interactions of proteins with an established role in the presynapse. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Moraes KC., Quaresma AJ., Maehnss K., Kobarg J. Synapse - Interactions of proteins with an established role in the presynapse. The interactions linked here relate to isoforms that do not interact. Accepted 2006-OCT-12 by JYOTI. Biol. Chem. (1431-6730) 2003 q14103-1 Heterogeneous nuclear ribonucleoprotein D0 p45 Dx9 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY D0B6EA177BEF789E hnrpq_human Heterogeneous nuclear ribonucleoprotein Q Synaptotagmin-binding, cytoplasmic RNA-interacting protein Glycine- and tyrosine-rich RNA-binding protein NS1-associated protein 1 SYNCRIP HNRPQ NSAP1 protein protein human Homo sapiens Human MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK DIP protein O60506 original sequence version: 144 DIP protein O60506 original sequence version: 124 0669FA604E8FBBDF q14103-2 Heterogeneous nuclear ribonucleoprotein D0 p42 Dx4 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY FEE18D61B7714B51 if2b2_human Insulin-like growth factor 2 mRNA-binding protein 2 IGF-II mRNA-binding protein 2 Hepatocellular carcinoma autoantigen p62 VICKZ family member 2 IGF2BP2 IMP2 VICKZ2 protein protein human Homo sapiens Human MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK DIP protein Q9Y6M1 original sequence version: 149 EA656F8733BBB39A ybox1_human Y-box-binding protein 1 YBX1 YB1 NSEP1 Y-box transcription factor CCAAT-binding transcription factor I subunit A Enhancer factor I subunit A DNA-binding protein B Nuclease-sensitive element-binding protein 1 protein protein human Homo sapiens Human MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE DIP protein P67809 original sequence version: 39 DF0114BF974AEDB8 q14103-4 Heterogeneous nuclear ribonucleoprotein D0 p37 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 263. Contains a N6-acetyllysine at position 273. 98DF6E78EAF3BBC1 hnrpd-syncrip-4 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association true Co-transformation experiments of the yeast strain L40 with pBTM116-AUF1- p37, -p40, -p42 and -p45 and pACT2-NSEP-1, pACT2-NSAP-1 and pACT2-IMP-2 (Figure 1C) demonstrated that the three RNA binding proteins NSEP-1, NSAP-1 and IMP-2 all interact only with AUF1p37 and p40 but not with p42 or p45. In contrast, protein UBCE2I interacted with all four isoforms. 1C NSAP-1 interacted only with AUF1p37 and p40 but not with p42 or p45. hnrpd-syncrip-5 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association true Co-transformation experiments of the yeast strain L40 with pBTM116-AUF1- p37, -p40, -p42 and -p45 and pACT2-NSEP-1, pACT2-NSAP-1 and pACT2-IMP-2 (Figure 1C) demonstrated that the three RNA binding proteins NSEP-1, NSAP-1 and IMP-2 all interact only with AUF1p37 and p40 but not with p42 or p45. In contrast, protein UBCE2I interacted with all four isoforms. 1C NSAP-1 interacted only with AUF1p37 and p40 but not with p42 or p45. hnrpd-ybx1-5 1 2 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association true Co-transformation experiments of the yeast strain L40 with pBTM116-AUF1- p37, -p40, -p42 and -p45 and pACT2-NSEP-1, pACT2-NSAP-1 and pACT2-IMP-2 (Figure 1C) demonstrated that the three RNA binding proteins NSEP-1, NSAP-1 and IMP-2 all interact only with AUF1p37 and p40 but not with p42 or p45. In contrast, protein UBCE2I interacted with all four isoforms. 1C NSEP-1 interacted only with AUF1p37 and p40 but not with p42 or p45. hnrpd-ybx1-6 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association true Co-transformation experiments of the yeast strain L40 with pBTM116-AUF1- p37, -p40, -p42 and -p45 and pACT2-NSEP-1, pACT2-NSAP-1 and pACT2-IMP-2 (Figure 1C) demonstrated that the three RNA binding proteins NSEP-1, NSAP-1 and IMP-2 all interact only with AUF1p37 and p40 but not with p42 or p45. In contrast, protein UBCE2I interacted with all four isoforms. 1C NSEP-1 interacted only with AUF1p37 and p40 but not with p42 or p45. hnrpd-igf2bp2-4 1 2 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association true Co-transformation experiments of the yeast strain L40 with pBTM116-AUF1- p37, -p40, -p42 and -p45 and pACT2-NSEP-1, pACT2-NSAP-1 and pACT2-IMP-2 (Figure 1C) demonstrated that the three RNA binding proteins NSEP-1, NSAP-1 and IMP-2 all interact only with AUF1p37 and p40 but not with p42 or p45. In contrast, protein UBCE2I interacted with all four isoforms. 1c IMP-2 interacted only with AUF1p37 and p40 but not with p42 or p45. hnrpd-igf2bp2-5 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association true Co-transformation experiments of the yeast strain L40 with pBTM116-AUF1- p37, -p40, -p42 and -p45 and pACT2-NSEP-1, pACT2-NSAP-1 and pACT2-IMP-2 (Figure 1C) demonstrated that the three RNA binding proteins NSEP-1, NSAP-1 and IMP-2 all interact only with AUF1p37 and p40 but not with p42 or p45. In contrast, protein UBCE2I interacted with all four isoforms. 1c IMP-2 interacted only with AUF1p37 and p40 but not with p42 or p45. hnrpd-hnrpd-2 1 7 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association true Our analysis revealed that AUF1p37 only interacts with the AUF1 isoforms p37 and p40 but not with p42 or p45 (Figure 1B). 1B hnrpd-hnrpd-3 1 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association true Our analysis revealed that AUF1p37 only interacts with the AUF1 isoforms p37 and p40 but not with p42 or p45 (Figure 1B). 1B