IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis for the selective activation of Rho GTPases by Dbl exchange factors. Structural basis for the selective activation of Rho GTPases by Dbl exchange factors. Nat. Struct. Biol. (1072-8368) 2002 Snyder JT., Worthylake DK., Rossman KL., Betts L., Pruitt WM., Siderovski DP., Der CJ., Sondek J. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Snyder JT., Worthylake DK., Rossman KL., Betts L., Pruitt WM., Siderovski DP., Der CJ., Sondek J. Synapse - Interactions of proteins with an established role in the presynapse. Nat. Struct. Biol. (1072-8368) 2002 Structural basis for the selective activation of Rho GTPases by Dbl exchange factors. Structural basis for the selective activation of Rho GTPases by Dbl exchange factors. Nat. Struct. Biol. (1072-8368) 2002 Snyder JT., Worthylake DK., Rossman KL., Betts L., Pruitt WM., Siderovski DP., Der CJ., Sondek J. Synapse - Interactions of proteins with an established role in the presynapse. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Snyder JT., Worthylake DK., Rossman KL., Betts L., Pruitt WM., Siderovski DP., Der CJ., Sondek J. Synapse - Interactions of proteins with an established role in the presynapse. Nucleotide exchange of G proteins was followed by the increase of relative fluorecence due to the loading of a fluorescent GTP analogue (mant-GTP). The acceleration of the exchange after GEF (GTP exchange facor) addition was calculated. table 1, fig 4 Nat. Struct. Biol. (1072-8368) 2002 q6pdm6_mouse Mcf2l protein protein mouse Mus musculus Mouse MALEEMVQRLNAVSKNTDEIMHQDIVPLCAADIQEQLKKRFAYLSGGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVPVMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHRTAIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVKEDLQLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFREVKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSSVAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLETSMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECILNQDLLEHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPGSWRSSENSSSEGNALRRGPYRRAKSEMSEPRQGRTSSTGEEEESLAILRRHVMNELLDTERAYVEELLCVLEGYAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNRIFLRELESCIDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDCPFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMTAVGITENVKGDTKKFEIWYNAREEVYIIQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSHSLPLPTPSSTSPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKDDAVPSSTSESSALSRKRFTLQGLANLKGQKASPTSPDKKAKRHEVKSDPTPFGLRGWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKLVPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAEGLWYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV D969135E4592F851 p60953-1 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Brain protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPPETQPKRKCCIF DIP protein P60953-1 original sequence version: 135 34B44F9225EC106B arhg5_human Rho guanine nucleotide exchange factor 5 Guanine nucleotide regulatory protein TIM Oncogene TIM p60 TIM Transforming immortalized mammary oncogene ARHGEF5 TIM Ephexin-3 protein protein human Homo sapiens Human MEAEEAQRGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQQSELRDVCDYAIETMPSFPKEGSADVEPNQESLVAEACDTPEHWEAVPQSLAGRQARTLAPPELWACPIQSEHLDMAPFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQTRYYSPCEEHPAETNQNEGSESGTIRQGEELPPEELQESQGLLHPQEVQVLEEQGQQEAGFRGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGLNDGEWEQEDMERKAQGQGGPEQGEERKRELQVPEENRADSQDEKSQTFLGKSEEVTGKQEDHGIKEKGVPVSGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCDLFPGASYLMTQIPGTQTESRAEELSPAALSPSLEPIRCSHQPISLLGSFLTEESPDKEIDQNSQQEESRLRKGTVSSQGTEVVFASASVTPPRTPDSAPPSPAEAYPITPASVSARPPVAFPRRETSCAARAPETASAPLSMDDPSPCGTSEMCPAALYGFPSTGTSPPRPPANSTGTVQHLRSDSFPGSHRTEQTPDLVGMLLSYSHSELPQRPPKPAIYSSVTPRRDRRSGRDYSTVSASPTALSTLKQDSQESISNLERPSSPPSIQPWVSPHNPAFATESPAYGSSPSFVSMEDVRIHEPLPPPPPQRRDTHPSVVETDGHARVVVPTLKQHSHPPPLALGSGLHAPHKGPLPQASDPAVARQHRPLPSTPDSSHHAQATPRWRYNKPLPPTPDLPQPHLPPISAPGSSRIYRPLPPLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPACQDWTVPLPASAGRTSWPPATARSTESFTSTSRSKSEVSPGMAFSNMTNFLCPSSPTTPWTPELQGPTSKDEAGVSEHPEAPAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSGQAVAPSEGANKHKGWSRQGLRRPSILPEGSSDSRGPAVEKHPGPSDTVVFREKKPKEVMGGFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETPGPSSPRQPRKALVSSESYLQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHFQLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVVLNHAPDFRRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITRLKLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRRTEELIYLSQKIEFECKIFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLVFDHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALAMPREELDLLECYNSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERGWFPVQQVEFISNPEVRAQNLKEAHRVKTAKLQLVEQQA 93EC1B1D7E1198C5 rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL DIP protein P61586 original sequence version: 86 DIP protein P61586 original sequence version: 123 DIP protein P61586 original sequence version: 57 DIP protein P61586 original sequence version: 88 DIP protein P61586 original sequence version: 87 DIP protein P61586 original sequence version: 85 DIP protein P61586 original sequence version: 125 DIP protein P61586 original sequence version: 132 C4DA2DC31FF858BC itsn1_human Intersectin-1 SH3 domain-containing protein 1A SH3P17 ITSN1 ITSN SH3D1A protein protein human Homo sapiens Human MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGIASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP DIP protein Q15811 original sequence version: 114 FC4DE644D8BEA2BE cdc42-itsn1-1 1 7 unspecified role unspecified role neutral component neutral component dh-ph domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P60953-1:p.Cys189Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:48:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys189ser' Tue Jun 30 16:19:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys189Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2.30A working 23.1%, free 24.7% isoform 2 The cysteine 188 of cdc42 which can be modified (S-geranylgeranyl cysteine) in eucaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein. cdc42-itsn1-2 2 7 enzyme enzyme unspecified role unspecified role dh-ph domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 enzyme target enzyme target substrate substrate unspecified role unspecified role region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P60953-1:p.Cys189Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:31:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys189ser' Tue Jun 30 16:34:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys189Ser' ecoli Escherichia coli (strain K12) physical association physical association The cysteine 188 of cdc42 which can be modified (S-geranylgeranyl cysteine)in eucaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein. rhoa-dbs-1 1 3 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range dh-ph binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role neutral component neutral component gly ala tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P61586:p.Cys190Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:18:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys190ser Wed May 02 15:53:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys190ser' Tue Jun 30 17:17:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys190Ser' region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction The Dbs sequence used is identical to P61586 which may be a splice isoform of Dbs (Q64096). 2.81A working 23.6%, free 26.6% The cysteine 190 of RhoA which can be modified (S-geranylgeranyl cysteine)in eucaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein. rhoa-dbs-2 2 6 enzyme target enzyme target substrate substrate unspecified role unspecified role P61586:p.Cys190Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:17:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys190ser Wed May 02 15:39:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys190ser' Tue Jun 30 17:35:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys190Ser' region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 3 enzyme enzyme unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range dh-ph binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association The cysteine 190 of RhoA which can be modified (S-geranylgeranyl cysteine)in eucaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein. The Dbs sequence used is identical to P61586 which may be a splice isoform of Dbs (Q64096). rhoa-arhgef5-3 2 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P61586:p.Cys190Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:07:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys190ser Wed May 02 19:40:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys190ser' Tue Jun 30 18:33:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys190Ser' ecobb Escherichia coli (strain B / BL21) 5 enzyme enzyme unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association The cysteine 190 of RhoA which can be modified (S-geranylgeranyl cysteine)in eucaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein.