MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. J. Neurosci. (0270-6474) 2001 Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. Alzheimers - Interactions investigated in the context of Alzheimers disease chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. J. Neurosci. (0270-6474) 2001 Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. Alzheimers - Interactions investigated in the context of Alzheimers disease human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. J. Neurosci. (0270-6474) 2001 Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. Alzheimers - Interactions investigated in the context of Alzheimers disease yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. J. Neurosci. (0270-6474) 2001 Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. Alzheimers - Interactions investigated in the context of Alzheimers disease chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 imaging technique imaging technique microscopy immunostaining immunostaining Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. J. Neurosci. (0270-6474) 2001 Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. Alzheimers - Interactions investigated in the context of Alzheimers disease in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. J. Neurosci. (0270-6474) 2001 Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. Alzheimers - Interactions investigated in the context of Alzheimers disease chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. J. Neurosci. (0270-6474) 2001 Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. Alzheimers - Interactions investigated in the context of Alzheimers disease chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK. J. Neurosci. (0270-6474) 2001 Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. Alzheimers - Interactions investigated in the context of Alzheimers disease yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Matsuda S., Yasukawa T., Homma Y., Ito Y., Niikura T., Hiraki T., Hirai S., Ohno S., Kita Y., Kawasumi M., Kouyama K., Yamamoto T., Kyriakis JM., Nishimoto I. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 2001 apbb1_mouse Amyloid beta precursor protein binding family B member 1 Apbb1 Fe65 Protein Fe65 Amyloid-beta A4 precursor protein-binding family B member 1 Rir protein protein mouse Mus musculus Mouse MSVPSSLSQSAINANSHGGPALSFPLPLHAAHNQLLNAKLQATAVVPKDLRSAMGEGSVPEPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEAETAPLGPKGLMHLYSELELSAHNAANRGLHGSALIINTQEQGPDEGEEKAAGEAEEDDEDEEEEEEEEDLSSPPGLPEPLENVEVPSGPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQLTWTGFAHQEGFEEGEFWKDEPSEEAPMELGLKDPEEATLSFPAQSLSPEPVPQEEEKLSQRNANPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMAGGWGEGKDLLLQLEDETLKLVEPQNQTLLHAQPIVSIRVWGVGRDSGSNRDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMSERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQTSTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGSQTP 9CFD571C50584979 jip1_human C-Jun-amino-terminal kinase-interacting protein 1 MAPK8IP1 IB1 JIP1 PRKM8IP JNK MAP kinase scaffold protein 1 Islet-brain 1 Mitogen-activated protein kinase 8-interacting protein 1 protein protein human Homo sapiens Human MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGLLSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAARRPGAGPPKAESGQEPASRGQGQSQGQSQGPGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQSGPAPTTDRGTSTDSPCRRSTATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVSSPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE 55EA53B30080A751 a4_mouse Amyloid-beta precursor protein App Alzheimer disease amyloid A4 protein homolog ABPP Amyloidogenic glycoprotein Amyloid precursor protein A4 AD1 Alzheimer disease amyloid protein Amyloid-beta (A4) precursor protein Amyloid-beta A4 protein protein protein mouse Mus musculus Mouse MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCVPFFYGGCGGNRNNFDTEEYCMAVCGSVSTQSLLKTTSEPLPQDPDKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN 988D89E089092A3E dab1_mouse Disabled homolog 1 Dab1 protein protein mouse Mus musculus Mouse MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPNSQPLEDFESRFAAATPNRNLSMDFDELLEATKVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPGSADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPSKSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS DIP protein P97318 original sequence version: 94 08404220792B1DB4 apbb3_mouse Amyloid-beta A4 precursor protein-binding family B member 3 Apbb3 Fe65l2 Protein Fe65-like 2 protein protein mouse Mus musculus Mouse MLGKDYMLAIILVNCDDDLWGDQNLEGETGLPPGWRKIRDAAGTYYWHVPSGSTQWQRPTWELPGAEDPGRGTEGIWELRPPKGRSFSSLDSSLNRSNSLTWYSEDSYVRSLEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRNRSQPHDGTWGEGQNMLMILKKDAMSLLNPLDHSLIHCQPLVHIRVWGVGSSKGRDRDFAFVAGDKDSCMLKCHVFHCDVPAKAIASALQGLCAQILSERVGVSGEAACCSPDPISPEDLPRQVELLDAVSQAAQKYEALYMGILPVTKAMGMDVLNEAIGTLTARGDRKTWVPAMLSVSDSLMTAHAIQAEAGAEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGCQSFQCAAFWCEPHAGGLSEAVQAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPPPLLKGGAGGAGAAPRKRGVFSFLDAFRLKPSLLHMS BEF1F66CAF10A139 jip1_mouse C-Jun-amino-terminal kinase-interacting protein 1 Mapk8ip1 Ib1 Jip1 Mapk8ip Prkm8ip Islet-brain-1 Mitogen-activated protein kinase 8-interacting protein 1 JNK MAP kinase scaffold protein 1 protein protein mouse Mus musculus Mouse MAERESGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGLLSAGSSGSAGSRLQAEMLQMDLIDAAGDTPGAEDDEEEEDDELAAQRPGVGPPKAESNQDPAPRSQGQGPGTGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQGSPVPTQDRGTSTDSPCRRSAATQMAPPSGPPATAPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDPAEPTSTFMPPTESRMSVSSDPDPAAYSVTAGRPHPSISEEDEGFDCLSSPERAEPPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASASSPYESAIGEEYEEAPQPRPPTCLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCVINGEEHEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDALEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE 274013B12D91049D p12023-2 Amyloid-beta precursor protein App ABPP Alzheimer disease amyloid A4 protein homolog Amyloidogenic glycoprotein Amyloid precursor protein A4 AD1 Alzheimer disease amyloid protein Amyloid-beta (A4) precursor protein Amyloid-beta A4 protein protein protein mouse Mus musculus Mouse MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN 0DE93FA56FB20F3A mk08_human Mitogen-activated protein kinase 8 MAPK8 JNK1 PRKM8 Stress-activated protein kinase JNK1 c-Jun N-terminal kinase 1 JNK-46 SAPK1 Stress-activated protein kinase 1c SAPK1C protein protein human Homo sapiens Human MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR DIP protein P45983 original sequence version: 96 DIP protein P45983 original sequence version: 185 DIP protein P45983 original sequence version: 124 DIP protein P45983 original sequence version: 103 94FB6BE0358B9B60 apba2_mouse Amyloid-beta A4 precursor protein-binding family A member 2 Apba2 X11l Neuron-specific X11L protein Neuronal Munc18-1-interacting protein 2 Adapter protein X11beta protein protein mouse Mus musculus Mouse MAHRKRQSTASSMLDHRARPGPIPHDQEPESEDTELPLESYVPTGLELGTLRPESPTPEEQECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGVTYYIRYCPEDDSYLEGMDCNGEEYIAHGAHPVDTDECQEAVEDWTDSVGPHTHSHGAENSQEYPDGHLPIPEDDPTVLEVHDQEEDGHYCSSKESYQDYYPPETNGNTGGASPYRMRRGDGDLEEQEEDIDQIVAEIKMSLSMTSITSASEASPEHMPELDPGDSTEACPPSDTGHGPGRQEARPKSLNLPPEVKHPGDLQRGLKTKTRTPEERPKWPQEQVCNGLEQPRKQQRSDLNGPTDNNNIPETKKVASFPSFVAVPGPCEAEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI FC231C966DB467DE apbb2_mouse Amyloid beta precursor protein binding family B member 2 Apbb2 Amyloid-beta (A4) precursor protein-binding family B member 2 Fe65l Fe65l1 Protein Fe65-like 1 protein protein mouse Mus musculus Mouse MSEVLPADSGVGTLAVFMASSGSTDIANRNSPATPPNTLNLRSSHNELLNAEIKHSDAKNSTPPKCRKKYALTNIQAAMGLSDPAVQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNKNLSPAAVINLTSEKLEVKDPHPQESSGCEILPSQPRRTKSFLNYYADLETSARELGQNLGPCQGVGEEKAQPGPGQAPVVIGNGDLLPQKPNKPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVNDIAGTYYWHIPTGTTQWERPVSIPADLHGSRKGSLSSVTPSPTPENEKQPWSDFAVLNGGKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHGDDDDSCSINSDPEAKCFAVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLSLENDMLSLVDPMDRSVLHSQPIVNIRVWGVGRDNGRERDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACSSLQERTNMSLDVPLQVDFPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP 9E66E34489F4D736 q9wvi9-1 C-Jun-amino-terminal kinase-interacting protein 1 Mapk8ip1 Ib1 Jip1 Mapk8ip Prkm8ip Islet-brain-1 Mitogen-activated protein kinase 8-interacting protein 1 JNK MAP kinase scaffold protein 1 protein protein mouse Mus musculus Mouse MAERESGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGLLSAGSSGSAGSRLQAEMLQMDLIDAAGDTPGAEDDEEEEDDELAAQRPGVGPPKAESNQDPAPRSQGQGPGTGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQGSPVPTQDRGTSTDSPCRRSAATQMAPPSGPPATAPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDPAEPTSTFMPPTESRMSVSSDPDPAAYSVTAGRPHPSISEEDEGFDCLSSPERAEPPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASASSPYESAIGEEYEEAPQPRPPTCLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCVINGEEHEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDALEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE 274013B12D91049D apba2_human Amyloid-beta A4 precursor protein-binding family A member 2 APBA2 MINT2 X11L Neuron-specific X11L protein Neuronal Munc18-1-interacting protein 2 Adapter protein X11beta protein protein human Homo sapiens Human MAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEEQECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEEYLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEAHDQEEDGHYCASKEGYQDYYPEEANGNTGASPYRLRRGDGDLEDQEEDIDQIVAEIKMSLSMTSITSASEASPEHGPEPGPEDSVEACPPIKASCSPSRHEARPKSLNLLPEAKHPGDPQRGFKPKTRTPEERLKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI C15AE9CFAEF51D85 apbb1_human Amyloid beta precursor protein binding family B member 1 APBB1 FE65 RIR Protein Fe65 Amyloid-beta A4 precursor protein-binding family B member 1 protein protein human Homo sapiens Human MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP DIP protein O00213 original sequence version: 77 FD4A2EF7E8D8E884 app-apbb1 3 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Prey: human adult brain library of an AD patient. Revisit when Protein Editor in place Bait: APP595-695 and APP649-695. app-apbb2 8 11 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Revisit when Protein Editor in place Bait: mouse APP595-695 and APP649-695.Prey: adult mouse brain library. app-apbb3-1 8 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Revisit when Protein Editor in place Bait: APP595-695 and APP649-695. Prey: adult mouse brain library. app-mdab1 8 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Bait: APP595-695 and APP649-695.Prey: adult mouse brain library. Revisit when Protein Editor in place app-apbb-2 3 11 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association Revisit when Protein Editor in place Bait: APP649-695. Prey: human adult brain library of an AD patient. app-apba-2 3 11 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Revisit when Protein Editor in place Bait: APP649-695. Prey: human adult brain library of an AD patient. app-mapk8ip1-3 5 19 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait physical association physical association app-apb2 5 11 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Revisit when Protein Editor in place Bait and prey:Bacterially expressed and purified.Bait:APP cytoplasmic domain. Prey: His-X11L 37-680. app-apbb1-3 5 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Revisit when Protein Editor in place Bait and prey: bacterially expressed and purified.Bait:APP cytoplasmic domain. Prey:His-Fe65 370-662. mapk8ip1-app-12 7 19 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-864888]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 711-711, sequence length 707 [EBI-864888]365-711 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-864885]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 771-771, sequence length 770 [EBI-864885]725-771 53 56 physical association physical association app-mapk8ip1-2 7 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Bait:GST-tagged APP cytoplasmic domain. Prey:HA-tagged IB1 360-711. Revisit when Protein Editor in place mapk8ip1-app-7 1 15 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mapk8ip1-app-8 1 15 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 19 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 11 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 association association mapk8ip1-app-9 1 15 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 19 unspecified role unspecified role bait bait chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association mapk8ip1-app-10 2 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Revisit when Protein Editor in place Prey: APPwt or the following APP695 FAD mutant;APP695 K595N/M596L. APP695 sequence:Swissprot Iso Id P12023-2. Bait T7-JIP1b. JIP1b is an isoform of JIP1: Swissprot IsoId=Q9WVI9-1 mapk8ip1-app-11 4 11 unspecified role unspecified role neutral component neutral component chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 14 unspecified role unspecified role neutral component neutral component region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 colocalization colocalization APP and JIPb are transfected JIP1b is an isoform of JIP1: Swissprot IsoId=Q9WVI9-1 mapk8-mapk8ip1-1 6 16 unspecified role unspecified role bait bait chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 11 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 19 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 association association Revisit when Protein Editor in place Bait:GST tagged;Prey:T7 tagged-Jip1b mapk8-mapk8ip-1 6 19 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Revisit when Protein Editor in place Bait:GST-tagged app-mapk8ip1-4 3 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Revisit when Protein Editor in place Bait: APP649-695 Prey: human adult brain library of an AD patient.