MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Increased circulating levels of Factor H-Related Protein 4 are strongly associated with age-related macular degeneration. Increased circulating levels of Factor H-Related Protein 4 are strongly associated with age-related macular degeneration. Nature communications 2020 imex curation Cipriani V., Lorés-Motta L., He F., Fathalla D., Tilakaratna V., McHarg S., Bayatti N., Acar İE., Hoyng CB., Fauser S., Moore AT., Yates JRW., de Jong EK., Morgan BP., den Hollander AI., Bishop PN., Clark SJ. Rare diseases - Interactions investigated in the context of Rare genetic disease vcipriani@vmul.ac.uk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Cipriani V., Lorés-Motta L., He F., Fathalla D., Tilakaratna V., McHarg S., Bayatti N., Acar İE., Hoyng CB., Fauser S., Moore AT., Yates JRW., de Jong EK., Morgan BP., den Hollander AI., Bishop PN., Clark SJ. Rare diseases - Interactions investigated in the context of Rare genetic disease vcipriani@vmul.ac.uk Accepted 2021-JAN-11 AT 20:54 GMT AT 20:54 GMT by LUANA Nature communications 2020 Only protein-protein interactions imex curation imex curation Increased circulating levels of Factor H-Related Protein 4 are strongly associated with age-related macular degeneration. Increased circulating levels of Factor H-Related Protein 4 are strongly associated with age-related macular degeneration. Nature communications 2020 imex curation Cipriani V., Lorés-Motta L., He F., Fathalla D., Tilakaratna V., McHarg S., Bayatti N., Acar İE., Hoyng CB., Fauser S., Moore AT., Yates JRW., de Jong EK., Morgan BP., den Hollander AI., Bishop PN., Clark SJ. Rare diseases - Interactions investigated in the context of Rare genetic disease vcipriani@vmul.ac.uk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay antibody detection identification by antibody antibody detection Cipriani V., Lorés-Motta L., He F., Fathalla D., Tilakaratna V., McHarg S., Bayatti N., Acar İE., Hoyng CB., Fauser S., Moore AT., Yates JRW., de Jong EK., Morgan BP., den Hollander AI., Bishop PN., Clark SJ. Rare diseases - Interactions investigated in the context of Rare genetic disease vcipriani@vmul.ac.uk Accepted 2021-JAN-11 AT 20:54 GMT AT 20:54 GMT by LUANA Nature communications 2020 Only protein-protein interactions imex curation imex curation Increased circulating levels of Factor H-Related Protein 4 are strongly associated with age-related macular degeneration. Increased circulating levels of Factor H-Related Protein 4 are strongly associated with age-related macular degeneration. Nature communications 2020 imex curation Cipriani V., Lorés-Motta L., He F., Fathalla D., Tilakaratna V., McHarg S., Bayatti N., Acar İE., Hoyng CB., Fauser S., Moore AT., Yates JRW., de Jong EK., Morgan BP., den Hollander AI., Bishop PN., Clark SJ. Rare diseases - Interactions investigated in the context of Rare genetic disease vcipriani@vmul.ac.uk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage weight by staining molecular weight estimation by staining weight by staining Cipriani V., Lorés-Motta L., He F., Fathalla D., Tilakaratna V., McHarg S., Bayatti N., Acar İE., Hoyng CB., Fauser S., Moore AT., Yates JRW., de Jong EK., Morgan BP., den Hollander AI., Bishop PN., Clark SJ. Rare diseases - Interactions investigated in the context of Rare genetic disease vcipriani@vmul.ac.uk Accepted 2021-JAN-11 AT 20:54 GMT AT 20:54 GMT by LUANA Nature communications 2020 Only protein-protein interactions imex curation imex curation fhr1_human Complement factor H-related protein 1 CFHR1 CFHL CFHL1 CFHL1P CFHR1P FHR1 HFL1 HFL2 H factor-like protein 1 H36 protein protein human Homo sapiens Human MWLLVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR C0A1B38B8B34B6EF q92496-3 Complement factor H-related protein 4 CFHR4 CFHL4 FHR4 FHR-4B protein protein human Homo sapiens Human MLLLINVILTLWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNFVTPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPICIKFCDMPVFENSRAKSNGMRFKLHDTLDYECYDGYEISYGNTTGSIVCGEDGWSHFPTCYNSSEKCGPPPPISNGDTTSFLLKVYVPQSRVEYQCQSYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCKLGYNANTSVLSFQAVCREGIVEYPRCE 503E04AB4C271424 p01024-pro_0000005911 Complement C3b alpha' chain C3 CPAMD1 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 protein protein human Homo sapiens Human SNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN 749 1663 1E32EA0CEA20EA81 cfai_human Complement factor I CFI IF C3B/C4B inactivator protein protein human Homo sapiens Human MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV F06070EFE6B572A1 cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR DIP protein P08603 original sequence version: 161 DIP protein P08603-1 original sequence version: 149 3C26D62A2BF9BFEE c3-cfhr4-2 2 4 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma 5 competitor competitor competitor prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction fig. 2g c3-cfh-26 2 8 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma 5 competitor competitor competitor prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction fig. 2g c3-cfh-27 1 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma 5 unspecified role unspecified role prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction fig. 2f c3-cfhr1-11 3 4 enzyme enzyme neutral component neutral component human-plasma homo sapiens blood plasma plasma blood plasma 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma 5 inhibitor inhibitor neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 ancillary ancillary neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction fig. 2i suppl.fig.4 c3-cfhr1-12 3 4 enzyme enzyme neutral component neutral component human-plasma homo sapiens blood plasma plasma blood plasma 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma 7 ancillary ancillary neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction fig. 2h suppl.fig.4