IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Cell 2019 imex curation Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro competition binding competition binding anti tag western anti tag western blot anti tag western Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... A reactive diazirine probe was incorporated at various locations on the nucleosome surface. Each version of the diazirine probed nucleosome was incubated with biotinylated CC peptides and cross-linking was induced with UV light. Reactions were then analyzed by western blotting. crosslinker: UV All the histone mutant positions have been remapped to the current Uniprot sequence. cigall_kadoch@dfci.harvard.edu Accepted 2020-APR-09 AT 11:40 BST AT 11:40 BST by KALPANAP Cell 2019 Only protein-protein interactions imex curation imex curation Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Cell 2019 imex curation Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... A reactive diazirine probe was incorporated at various locations on the nucleosome surface. Each version of the diazirine probed nucleosome was incubated with biotinylated CC peptides and cross-linking was induced with UV light. Reactions were then analyzed by western blotting. crosslinker: UV All the histone mutant positions have been remapped to the current Uniprot sequence. cigall_kadoch@dfci.harvard.edu Accepted 2020-APR-09 AT 11:40 BST AT 11:40 BST by KALPANAP Cell 2019 Only protein-protein interactions imex curation imex curation Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Cell 2019 imex curation Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... SMARCB1-deficient HEK293T cells were used SMARCB1 was inferred to be human by general context, by sequence length and by mutations mapping. Mutation R37H shown in Fig. 1C was not captured because of an incongruence with other parts of the manuscript. cigall_kadoch@dfci.harvard.edu Accepted 2020-APR-09 AT 11:40 BST AT 11:40 BST by KALPANAP Cell 2019 Only protein-protein interactions imex curation imex curation Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Cell 2019 imex curation Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... Histone H3 and H2B uniprotAC from Fig. 2b,2c and S2e have been extracted from antibody datasheet, as provided in star methods. Histones' uniprotAC from Fig. 3e have been extracted from star methods (Recombinant Nucleosome Preparation). All the histone mutant positions have been remapped to the current Uniprot sequence. cigall_kadoch@dfci.harvard.edu Accepted 2020-APR-09 AT 11:40 BST AT 11:40 BST by KALPANAP Cell 2019 Only protein-protein interactions imex curation imex curation Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Cell 2019 imex curation Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight by staining molecular weight estimation by staining weight by staining Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu Accepted 2020-APR-09 AT 11:40 BST AT 11:40 BST by KALPANAP Cell 2019 Only protein-protein interactions imex curation imex curation Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Cell 2019 imex curation Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... SMARCB1-deficient HEK293T cells were used SMARCB1 was inferred to be human by general context, by sequence length and by mutations mapping. cigall_kadoch@dfci.harvard.edu Accepted 2020-APR-09 AT 11:40 BST AT 11:40 BST by KALPANAP Cell 2019 Only protein-protein interactions imex curation imex curation Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Cell 2019 imex curation Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-g401 human G-401 cells g401 G-401 cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... SMARCB1 was inferred to be human by general context, by sequence length and by mutations mapping. cigall_kadoch@dfci.harvard.edu Accepted 2020-APR-09 AT 11:40 BST AT 11:40 BST by KALPANAP Cell 2019 Only protein-protein interactions imex curation imex curation Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Recurrent SMARCB1 Mutations Reveal a Nucleosome Acidic Patch Interaction Site That Potentiates mSWI/SNF Complex Chromatin Remodeling. Cell 2019 imex curation Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... cigall_kadoch@dfci.harvard.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Valencia AM., Collings CK., Dao HT., St Pierre R., Cheng YC., Huang J., Sun ZY., Seo HS., Mashtalir N., Comstock DE., Bolonduro O., Vangos NE., Yeoh ZC., Dornon MK., Hermawan C., Barrett L., Dhe-Paganon S., Woolf CJ., Muir TW., Kadoch C. Rare diseases - Interactions investigated in the context of Rare genetic disease very nasty one! I haven't curated CHIPseq as I normally don't... SMARCB1-deficient HEK293T cells were used SMARCB1 was inferred to be human by general context, by sequence length and by mutations mapping. cigall_kadoch@dfci.harvard.edu Accepted 2020-APR-09 AT 11:40 BST AT 11:40 BST by KALPANAP Cell 2019 Only protein-protein interactions imex curation imex curation smce1_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 BRG1-associated factor 57 SMARCE1 BAF57 protein protein human Homo sapiens Human MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE DIP protein Q969G3 original sequence version: 86 DIP protein Q969G3 original sequence version: 78 DIP protein Q969G3 original sequence version: 97 6F1C1B7917BAD506 q21831_caeel snfc-5 CELE_R07E5.3 R07E5.3 protein protein caeel Caenorhabditis elegans MSSSTKTLSQTYGPRPQSFSLDEAGERYYIGSEIGAYLRLHRGTLYKKYPLLWRKVATSDDKDKLKQIAMSNAFLHTNIMLLRAHEVDELLDGSEEKYRAAGAAPSTPRTEGASRTVAKTPATGWAGQQVTSGSHHLESVPCSCPIAHSRGRMKHRELVYSAEDLEMSKRVMKNAEEGEDLVPIRLDMELDGIKLRDTFTFNKNEKMITPEMIAEIMCEDLDLPLAVFQPAITAAINQQLEASTEAPPLDVNICDQRAVLKLNINVGNQSLVDQFEWDMSDPNNSPEEFSRNICKELGLGGEFMSGIAYSIRGQLQWNQRTYAFSESPLATVDCPFRTSSEVESWGPFLETLTDAEIEKKMRDQDRNTRRMRRLVGGGFNY 8EEE824DDC370060 smrc2_human SWI/SNF complex subunit SMARCC2 SMARCC2 BAF170 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2 SWI/SNF complex 170 kDa subunit BRG1-associated factor 170 protein protein human Homo sapiens Human MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHHHHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ DIP protein Q8TAQ2 original sequence version: null DIP protein Q8TAQ2 original sequence version: 76 DIP protein Q8TAQ2 original sequence version: 95 EEFC1042A9296320 sfh1_yeast Chromatin structure-remodeling complex subunit SFH1 SFH1 YLR321C L8543.4 RSC complex subunit SFH1 SNF5 homolog 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHQNQLIPQAYISNFHNRLTNEDDGIPIFTMAQQTRQHKRAKVVNYAEYDNDLFDEFNMNGSNFNNADTHYKDNAVSHENTPALTNGVTMDGSEYNVLENMNGADSIISNNKYDAGSNMVVESLSGLNSNNNASNGPSNKAQAQDIGNAVLPDLQDQHHNPFNILRYPKIRDTFINGKVVSPYRLNTDQETKANANSGEAIMIPITLDIEHMGHTIKDQFLWNYNDDSISPEEFASIYCKDLDMTSATLQTQIANIIKEQLKDLENIAATEIMSDLHVIINLTCNLQDRFFEDNFQWNLNDKSLTPERFATSIVQDLGLTREFIPLISQSLHETILKIKKDWVDGHLIQDHVPNDAAFGYLSGIRLDIDELGSNWCPRVEILTKEEIQKREIEKERNLRRLKRETDRLSRRGRRRLDDLETTMRM C8D6F151249E8479 pb1_human Protein polybromo-1 Polybromo-1D BRG1-associated factor 180 PBRM1 PB1 BAF180 protein protein human Homo sapiens Human MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMAKSSLRMRTPSNLAAARLTGPSHSKGSLGEERNPTSKYYRNKRAVQGGRLSAITMALQYGSESEEDAALAAARYEEGESEAESITSFMDVSNPFYQLYDTVRSCRNNQGQLIAEPFYHLPSKKKYPDYYQQIKMPISLQQIRTKLKNQEYETLDHLECDLNLMFENAKRYNVPNSAIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMFEVLERARRMNRTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHNDVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRYSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAYFYGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEERAAKVAEQQERERAAQQQQPSASPRAGTPVGALMGVVPPPTPMGMLNQQLTPVAGMMGGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIRQAYNLENV DIP protein Q86U86 original sequence version: 66 DIP protein Q86U86 original sequence version: 83 0A656E319C4FC748 h2b1b_human Histone H2B type 1-B H2BC3 H2B-clustered histone 3 H2BFF HIST1H2BB Histone H2B.1 Histone H2B.f protein protein human Homo sapiens Human MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK DIP protein P33778 original sequence version: 97 DIP protein P33778 original sequence version: 146 D2D6B95A9A344EF7 smrc1_human SWI/SNF complex subunit SMARCC1 SMARCC1 BAF155 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 SWI/SNF complex 155 kDa subunit BRG1-associated factor 155 protein protein human Homo sapiens Human MAAAAGGGGPGTAVGATGSGIAAAAAGLAVYRRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEKMEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKELTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPGNILGPRVPLTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPPASAAP DIP protein Q92922 original sequence version: 99 EDA6FF5B0472AEA9 smrd3_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 SMARCD3 BAF60C 60 kDa BRG-1/Brm-associated factor subunit C BRG1-associated factor 60C protein protein human Homo sapiens Human MAADEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDLSVRCTLLLMLDYQPPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQRLTALLLPPDPIVINHVISVDPSDQKKTACYDIDVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT DIP protein Q6STE5 original sequence version: 66 B7B28DD11DCD0B5C snf5_yeast SWI/SNF chromatin-remodeling complex subunit SNF5 SNF5 SWI10 TYE4 YBR2036 YBR289W SWI/SNF complex subunit SNF5 Transcription regulatory protein SNF5 Transcription factor TYE4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNQPQGTNSVPNSIGNIFSNIGTPSFNMAQIPQQLYQSLTPQQLQMIQQRHQQLLRSRLQQQQQQQQQTSPPPQTHQSPPPPPQQSQPIANQSATSTPPPPPAPHNLHPQIGQVPLAPAPINLPPQIAQLPLATQQQVLNKLRQQAIAKNNPQVVNAITVAQQQVQRQIEQQKGQQTAQTQLEQQRQLLVQQQQQQQLRNQIQRQQQQQFRHHVQIQQQQQKQQQQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQGQIPQSQQVPQVRSMSGQPPTNVQPTIGQLPQLPKLNLPKYQTIQYDPPETKLPYPTYWSDKKADTDTLLYEQIIQRDKINKYSLIRETNGYDPFSIYGFSNKEYISRLWHTLKYYQDLKNTRMKSITSTSQKIPSASIWGNGYSGYGNGITNTTTRVIPQVEVGNRKHYLEDKLKVYKQAMNETSEQLVPIRLEFDQDRDRFFLRDTLLWNKNDKLIKIEDFVDDMLRDYRFEDATREQHIDTICQSIQEQIQEFQGNPYIELNQDRLGGDDLRIRIKLDIVVGQNQLIDQFEWDISNSDNCPEEFAESMCQELELPGEFVTAIAHSIREQVHMYHKSLALLGYNFDGSAIEDDDIRSRMLPTITLDDVYRPAAESKIFTPNLLQISAAELERLDKDKDRDTRRKRRQGRSNRRGMLALSGTSASNTSMNGVHNTVAAGNASSLPPGEILLPDIADIPRTFRTPVPSTLMPGGVDVGPSVESYELRNTTTYKSRPDRPKPVSPPCYIIDHIPGHSLLLSIKLPGKVNTKEEFAAAPNDTSSGTNAMLPSPESLKTKLNSNIRAGVTIPSIPNPIANHTVTNSPNPTLQPVIPGGAASKSVPTPSLPIAPPVAPHDSEATLLTNSNNGSSNNNTQNT F6D31A57E6D6DA94 F6D31A57E6D6DA94 h2a2a_human Histone H2A type 2-A H2AC18 H2AC19 H2A-clustered histone 18 H2A-clustered histone 19 H2AFO HIST2H2AA HIST2H2AA3 HIST2H2AA4 Histone H2A.2 Histone H2A/o protein protein human Homo sapiens Human MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK DIP protein Q6FI13 original sequence version: 76 53AEDC6CE3FE8317 phf10_human PHD finger protein 10 XAP135 PHF10 BAF45A BRG1-associated factor 45a protein protein human Homo sapiens Human MAAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETSSQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG 05EFDABD2000C2B7 acl6a_human Actin-like protein 6A 53 kDa BRG1-associated factor A Actin-related protein Baf53a ArpNbeta BAF53A ACTL6A BAF53 INO80K INO80 complex subunit K BRG1-associated factor 53A protein protein human Homo sapiens Human MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP ECD92D29BD1854E0 arid2_human AT-rich interactive domain-containing protein 2 BRG1-associated factor 200 Zinc finger protein with activation potential Zipzap/p200 ARID2 KIAA1557 BAF200 protein protein human Homo sapiens Human MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKPQLPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVCTLLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDIVDDNEVRDLISDRNKSHEGTSGEWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEEGNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVTKCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSYREIICHLTLPDVLLVISTLEVLYMLTEMGDVACTKIAKVEKSIDMLVCLVSMDIQMFGPDALAAVKLIEHPSSSHQMLSEIRPQAIEQVQTQTHVASAPASRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSVSRAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVKRRAIPLPIQMYYQQQPVSTSVVRVDSVPDVSPAPSPAGIPHGSQTIGNHFQRTPVANQSSNLTATQMSFPVQGVHTVAQTVSRIPQNPSPHTHQQQNAPVTVIQSKAPIPCEVVKATVIQNSIPQTGVPVSIAVGGGPPQSSVVQNHSTGPQPVTVVNSQTLLHHPSVIPQQSPLHTVVPGQIPSGTPVTVIQQAVPQSHMFGRVQNIPACTSTVSQGQQLITTSPQPVQTSSQQTSAGSQSQDTVIIAPPQYVTTSASNIVSATSVQNFQVATGQMVTIAGVPSPQASRVGFQNIAPKPLPSQQVSSTVVQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLANPAALPAGQTVQLTGQPNITPSSSPSPVPATNNQVPTAMSSSSTPQSQGPPPTVSQMLSVKRQQQQQHSPAPPPQQVQVQVQQPQQVQMQVQPQQSNAGVGQPASGESSLIKQLLLPKRGPSTPGGKLILPAPQIPPPNNARAPSPQVVYQVASNQAAGFGVQGQTPAQQLLVGQQNVQLVPSAMPPSGGVQTVPISNLQILPGPLISNSPATIFQGTSGNQVTITVVPNTSFAPATVSQGNATQLIAPAGITMSGTQTGVGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEAKEATGLHVHERKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRKYSDSSLPPSNSGKIQSETNQCSLISNGPSLELGENGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDITQQDTAKGDQLERISNGPVLTLGGSSVSSIQEASNAATQQFSGTDLLNGPLASSLNSDVPQQRPSVVVSPHSTTSVIQGHQIIAVPDSGSKVSHSPALSSDVRSTNGTAECKTVKRPAEDTDRETVAGIPNKVGVRIVTISDPNNAGCSATMVAVPAGADPSTVAKVAIESAVQQKQQHPPTYVQNVVPQNTPMPPSPAVQVQGQPNSSQPSPFSGSSQPGDPMRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRFSFITHLQDKHCSKDALLAGLKQDEPGQAGSQKSSTKQPTVGGTSSTPRAQKAIVNHPSAALMALRRGSRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVLAISNMEASSTLAKCLYELNFTVQSKEQEKDSEMLQ DIP protein Q68CP9 original sequence version: 62 DIP protein Q68CP9 original sequence version: 80 F540A029FA2264D4 bcl7b_human B-cell CLL/lymphoma 7 protein family member B BCL7B protein protein human Homo sapiens Human MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES 0280371283A02107 q24090_drome Snr1 BAP45 Dmel\CG1064 SNR1 Snr Snr-1 l(3)01319 snr snr-1 snr1 Dmel_CG1064 CG1064 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MALQTYGDKPVAFQLEEGGEYYYVGSEVGNYMRHFRGILYKKYPGMTRIVLSNEERKRLAESGLSSHILASSVSLLRAVEVDDIMAGNDEKYRAVSVNTSDTPVPRESKSKKQPQYVPTMPNSSHLDAVPQATPINRNRVHTKKVRTFPMCFDDTDPTASLENAAQKECLVPIRLDMELEGQKLRDTFTWNKNESMITPEQFAEVLCDDLDLNPLPFVPAIAQAIRQQIEAFPNDPPILEETCDQRVIVKLNIHVGNTSLVDQVEWDMSEKNNNPEEFAIKLCAELGLGGEFVTAIAYSIRGQLSWHCRTYAFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKIRDQDRNTRRMRRLANTTTGW DIP protein Q24090 original sequence version: 80 C6154768FCEA997D dpf3_human Zinc finger protein DPF3 DPF3 BAF45C BRG1-associated factor 45C CERD4 Zinc finger protein cer-d4 protein protein human Homo sapiens Human MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKRHRGPGLAPGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEALLRGEGVEKKVDAREEESIQEIQRVLENDENVEEGNEEEDLEEDIPKRKNRTRGRARGSAGGRRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPNHRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKASAFGCQA 7E6A6FD07A0E4668 crest_human Calcium-responsive transactivator SYT homolog 1 KIAA0693 SS18L1 CREST SS18-like protein 1 protein protein human Homo sapiens Human MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLLPAPPTQNMNLGPGALTQSGSSQGLHSQGSLSDAISTGLPPSSLLQGQIGNGPSHVSMQQTAPNTLPTTSMSISGPGYSHAGPASQGVPMQGQGTIGNYVSRTNINMQSNPVSMMQQQAATSHYSSAQGGSQHYQGQSSIAMMGQGSQGSSMMGQRPMAPYRPSQQGSSQQYLGQEEYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQHYYEGGNSQYSQQQAGYQQGAAQQQTYSQQQYPSQQSYPGQQQGYGSAQGAPSQYPGYQQGQGQQYGSYRAPQTAPSAQQQRPYGYEQGQYGNYQQ B76B7D61C7DF5592 h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P68431 original sequence version: 78 DIP protein P68431 original sequence version: 79 DIP protein P68431 original sequence version: 76 DIP protein P68431 original sequence version: 92 DIP protein P68431 original sequence version: 87 DIP protein P68431 original sequence version: 101 DIP protein P68431 original sequence version: 130 DIP protein P68431 original sequence version: 115 9B89008EA50A0EF6 smca4_human Transcription activator BRG1 SMARCA4 BRG1 SNF2B SNF2L4 ATP-dependent helicase SMARCA4 SNF2-beta BAF190A Mitotic growth and transcription activator Protein BRG-1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 Protein brahma homolog 1 BRG1-associated factor 190A protein protein human Homo sapiens Human MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein P51532 original sequence version: 125 DIP protein P51532 original sequence version: 115 DIP protein P51532 original sequence version: 154 DIP protein P51532 original sequence version: 136 DIP protein P51532-1 original sequence version: 136 ABDA5EDBF10D7D28 ari1b_human AT-rich interactive domain-containing protein 1B BAF250B Osa homolog 2 p250R BRG1-binding protein hELD/OSA1 BRG1-associated factor 250b ARID1B DAN15 KIAA1235 OSA2 protein protein human Homo sapiens Human MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLSKPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGGSSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPYYSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPNHEDLNLIQQERPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSHPALSQSPMPQERGFMAGTQRNPQMAQYGPQQTGPSMSPHPSPGGQMHAGISSFQQSNSSGTYGPQMSQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFPGMNQSGLMASSSPYSQPMNNSSSLMNTQAPPYSMAPAMVNSSAASVGLADMMSPGESKLPLPLKADGKEEGTPQPESKSKKSSSSTTTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPPPEVFSTGDTKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAEVPGDLKPPTPASTPHGQMTPMQGGRSSTISVHDPFSDVSDSSFPKRNSMTPNAPYQQGMSMPDVMGRMPYEPNKDPFGGMRKVPGSSEPFMTQGQMPNSSMQDMYNQSPSGAMSNLGMGQRQQFPYGASYDRRHEPYGQQYPGQGPPSGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWPSHVSQRQPYMSSSASMQPITRPPQPSYQTPPSLPNHISRAPSPASFQRSLENRMSPSKSPFLPSMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQKALDHNAARKDDSQSLADDSGKEEEDAECIDDDEEDEEDEEEDSEKTESDEKSSIALTAPDAAADPKEKPKQASKFDKLPIKIVKKNNLFVVDRSDKLGRVQEFNSGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSAGRKKEQEGKGDSEEQQEKSIIATIDDVLSARPGALPEDANPGPQTESSKFPFGIQQAKSHRNIKLLEDEPRSRDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGDALAARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNSLVASVICDVLFQIGQL 4538B4747606C918 ari1a_human AT-rich interactive domain-containing protein 1A hELD SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 SWI/SNF complex protein p270 B120 SWI-like protein Osa homolog 1 BRG1-associated factor 250 BRG1-associated factor 250a ARID1A C1orf4 SMARCF1 OSA1 BAF250 BAF250A protein protein human Homo sapiens Human MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS 85BC5B6061625D8E bcl7c_human B-cell CLL/lymphoma 7 protein family member C BCL7C protein protein human Homo sapiens Human MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP mint homomint May play an anti-apoptotic role 379CDFFF250195A5 dpf1_human Zinc finger protein neuro-d4 D4, zinc and double PHD fingers family 1 DPF1 NEUD4 BAF45B BRG1-associated factor 45B protein protein human Homo sapiens Human MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDRDKPYVCDKFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASAYITLT C3550A83807B4FDB brd7_human Bromodomain-containing protein 7 75 kDa bromodomain protein Protein CELTIX-1 BRD7 BP75 CELTIX1 protein protein human Homo sapiens Human MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKDMLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPIVGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFANISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS DIP protein Q9NPI1 original sequence version: 69 DIP protein Q9NPI1-1 original sequence version: 82 29B7947644C215E7 smrd2_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 PRO2451 SMARCD2 BAF60B 60 kDa BRG-1/Brm-associated factor subunit B BRG1-associated factor 60B protein protein human Homo sapiens Human MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFRPMGPAGPAAQYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT DIP protein Q92925 original sequence version: 75 8C92168AE7782814 probe_wh INI1 Winged Helix DNA Binding DNA ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) GGAATTGTGAGCGCTCACAATTCC ssxt_human Protein SSXT SS18 SSXT SYT Synovial sarcoma translocated to X chromosome protein Protein SYT protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ 7E089D557538252F smca2_human Probable global transcription activator SNF2L2 ATP-dependent helicase SMARCA2 SNF2-alpha SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 SMARCA2 BRM SNF2A SNF2L2 BAF190B Protein brahma homolog BRG1-associated factor 190B protein protein human Homo sapiens Human MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTMGSTDFPQEGMHQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGYMSPHPSPLGAPEHVSSPMSGGGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGKRTLPGLQQQQQQQQQQQQQQQQQQQQQQQPQQQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPVPAPGGRPSPAPPAAAQPPAAAVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESDSDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEEEEEDEEESESEAKSVKVKIKLNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDEREQSEGSGTDDE DIP protein P51531 original sequence version: 66 DIP protein P51531 original sequence version: 126 CE69BBB287D35AB5 snf5_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 SMARCB1 INI1 SNF5L1 Integrase interactor 1 protein BAF47 SNF5 homolog BRG1-associated factor 47 protein protein human Homo sapiens Human MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW B7BCA26875BD943D bcl7a_human B-cell CLL/lymphoma 7 protein family member A BCL7A protein protein human Homo sapiens Human MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM 4AB4AC3B309ADDB8 brd9_human Bromodomain-containing protein 9 BRD9 Rhabdomyosarcoma antigen MU-RMS-40.8 UNQ3040/PRO9856 protein protein human Homo sapiens Human MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHERERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEPPPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQCALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLGDSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAERGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT 3B248FA97948266E smrd1_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 SMARCD1 BAF60A SWI/SNF complex 60 kDa subunit 60 kDa BRG-1/Brm-associated factor subunit A BRG1-associated factor 60A protein protein human Homo sapiens Human MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT DIP protein Q96GM5 original sequence version: null DIP protein Q96GM5 original sequence version: 75 E683AA1E345DA400 h2b1k_human Histone H2B type 1-K H2BC12 H2BFT HIRA-interacting protein 1 HIRIP1 HIST1H2BK protein protein human Homo sapiens Human MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK DIP protein O60814 original sequence version: 92 FAF9279F44BE703D h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 lana1_hhv8p Protein LANA1 LANA1 ORF73 protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MAPPGMRLRSGRSTGAPLTRGSCRKRNRSPERCDLGDDLHLQPRRKHVADSVDGRECGPHTLPIPGSPTVFTSGLPAFVSSPTLPVAPIPSPAPATPLPPPALLPPVTTSSSPIPPSHPVSPGTTDTHSPSPALPPTQSPESSQRPPLSSPTGRPDSSTPMRPPPSQQTTPPHSPTTPPPEPPSKSSPDSLAPSTLRSLRKRRLSSPQGPSTLNPICQSPPVSPPRCDFANRSVYPPWATESPIYVGSSSDGDTPPRQPPTSPISIGSSSPSEGSWGDDTAMLVLLAEIAEEASKNEKECSENNQAGEDNGDNEISKESQVDKDDNDNKDDEEEQETDEEDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEEDEEEDEEEDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQELEEVEEQEQEQEEQEEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQGVEQQEQETVEEPIILHGSSSEDEMEVDYPVVSTHEQIASSPPGDNTPDDDPQPGPSREYRYVLRTSPPHRPGVRMRRVPVTHPKKPHPRYQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQPGENQGPGDSPQEMT DIP protein Q9QR71 original sequence version: 51 requ_human Zinc finger protein ubi-d4 DPF2 REQ UBID4 Protein requiem Apoptosis response zinc finger protein D4, zinc and double PHD fingers family 2 BAF45D BRG1-associated factor 45D protein protein human Homo sapiens Human MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS 1044B4D3036075FC smarc1b-1 8 27 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 37 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed Q12824:p.Lys364del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 18:40:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg366Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 18:55:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg366Cys' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q12824:p.Lys363Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K N Tue Jun 30 17:49:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys363Asn' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association Fig. 1B smarcb1-smarcb1-1 6 27 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 37 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed Q12824:p.Lys364del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 17:52:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg366Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 16:17:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg366Cys' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q12824:p.Lys363Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K N Tue Jun 30 15:55:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys363Asn' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association Fig. S1G smarcb1-smarca4-3 6 27 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 37 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed Q12824:p.Lys364del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 17:19:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg366Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 17:08:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg366Cys' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q12824:p.Lys363Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K N Tue Jun 30 16:05:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys363Asn' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association Fig. S1G smarcb1-smarca4-4 3 21 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 13 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 36 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 29 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 28 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 30 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 39 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 35 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 25 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 31 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 22 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 24 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 38 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 19 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 44 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 32 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 20 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 33 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 40 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 16 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 27 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 9 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 15 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 11 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 37 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed p.Lys364del mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain K . p.Arg366Cys mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain R C ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q12824:p.Lys363Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K N Tue Jun 30 16:58:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys363Asn' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association Fig. 1C-D, Table S2 smarcb1-actl6a-4 3 21 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 13 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 36 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 29 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 28 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 30 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 39 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 25 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 31 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 22 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 24 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 38 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 19 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 44 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 32 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 20 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 33 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 40 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 16 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 27 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 9 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 15 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 11 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 37 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed Q12824:p.Arg366Cys mutation mutation certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 19:33:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg366Cys' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. 1C-D, Table S2 smarcb1-actl6a-5 3 21 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 13 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 36 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 29 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 28 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 30 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 39 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 25 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 22 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 24 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 38 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 19 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 44 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 32 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 20 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 33 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 40 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 16 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 27 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 9 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 15 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 11 weight silver stain molecular weight estimation by silver staining weight silver stain sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 37 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed Q12824:p.Lys364del mutation mutation certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 19:54:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. 1C-D, Table S2 smarca4-smarcb1-4 6 29 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 27 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 37 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed Q12824:p.Lys364del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 16:03:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg37His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 17:43:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg37His' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. S1L smarcb1-smarca4-5 7 27 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 37 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. S1H h3-smarcb1-1 4 26 unspecified role unspecified role prey prey partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 14 unspecified role unspecified role prey prey partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 37 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys363Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K N Tue Jun 30 19:17:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys363Asn' Q12824:p.Lys364del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 18:25:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg366Cys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 17:08:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg366Cys' Q12824:p.Arg374Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 18:21:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg374Gln' Q12824:p.Arg377His mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 19:52:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 2B smarcb1-h3c1-1 4 26 unspecified role unspecified role prey prey partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 17 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 2C snf5-h3c1-1 4 12 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 26 unspecified role unspecified role prey prey partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 2C sfh1-h3c1-1 4 10 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 26 unspecified role unspecified role prey prey partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 2C snf5-h3c1-2 4 26 unspecified role unspecified role prey prey partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 23 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 2C smarcb1-h3c1-2 4 26 unspecified role unspecified role prey prey partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 37 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys363Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 19:19:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys363Ala' Q12824:p.Lys364del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 18:32:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Lys364Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 19:45:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364Arg' Q12824:p.Lys364Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 18:10:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364Glu' Q12824:p.Lys364Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 18:45:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364Ala' Q12824:p.Lys363_Lys364delinsGluGlu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain KK EE Tue Jun 30 17:25:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys363_Lys364delinsGluGlu' Q12824:p.Arg370Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 20:14:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg370Ala' Q12824:p.Ile365Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I A Tue Jun 30 20:09:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile365Ala' Q12824:p.Lys364Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K P Tue Jun 30 19:03:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364Pro' Q12824:p.Lys363_Lys364delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain KK AA Tue Jun 30 17:01:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys363_Lys364delinsAlaAla' chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 2C, Fig. S2E smarcb1-h3c1-3 4 37 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 26 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role ancillary ancillary partially purified partially purified Q6FI13:p.Asp91Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D N Tue Jun 30 16:47:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp91Asn' Q6FI13:p.Glu93Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 18:33:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu93Lys' ecoli Escherichia coli (strain K12) association association Fig. 3E smarcb1-h3c1-4 4 37 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 26 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) 41 unspecified role unspecified role ancillary ancillary partially purified partially purified O60814:p.Glu114Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 16:00:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu114Lys' ecoli Escherichia coli (strain K12) association association Fig. 3E wh-dna-1 5 37 unspecified role unspecified role prey prey purified purified WH region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 34 unspecified role unspecified role bait bait purified purified IR dye dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. S2C positive control smarcb1-h3c1-5 2 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 16:29:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 20:03:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 42 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 242 238 physical association physical association Fig. 3A-C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). hist2h2aa3-smarcb1-1 2 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 17:40:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 20:11:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 250 246 physical association physical association Fig. 3A-C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). hist2h2aa3-smarcb1-2 2 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 19:55:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 15:35:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 41 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 254 258 physical association physical association Fig. 3A-C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). smarcb1-h3c1-6 4 43 competitor competitor competitor neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 26 unspecified role unspecified role prey prey partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 37 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. S3A Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C) h4_16-smarcb1-1 2 43 competitor competitor competitor neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 18:18:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 17:59:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 42 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. S3B This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C) hist2h2aa3-smarcb1-3 1 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 18:29:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 18:26:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 3A-C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). h2bc12-smarcb1-1 1 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 18:27:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 18:17:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 41 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 3A-C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). h4_16-lana1-1 2 43 competitor competitor competitor neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 20:03:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 17:45:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. S3B This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C) h4_16-lana1-2 2 43 competitor competitor competitor neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 16:35:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 19:55:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 41 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. S3B This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C) hist2h2aa3-lana1-1 2 43 competitor competitor competitor neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ha tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 18:47:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 16:36:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. S3C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C) h2bc12-lana1-1 2 43 competitor competitor competitor neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 37 unspecified role unspecified role neutral component neutral component purified purified biotin tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region CTD sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q12824:p.Lys364del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 19:21:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys364del' Q12824:p.Arg377His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 18:16:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg377His' chemical synthesis Chemical synthesis (Chemical synthesis) 41 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. S3C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C) h4_16-lana1-3 2 43 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 42 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 342 339 physical association physical association Fig. S3C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C) hist2h2aa3-lana1-2 2 18 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 43 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 347 345 physical association physical association Fig. S3C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C) h2bc12-lana1-2 2 41 unspecified role unspecified role neutral component neutral component partially purified partially purified diazarine cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 43 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 351 353 physical association physical association Fig. S3C This “photoscanning” approach indicated that the SMARCB1 CTD interacts with an extended region of the nucleosome that includes the canonical acidic patch, a key binding epitope on the nucleosome surface (interaction sites H2AE91 and H4E52 and to a lesser extent H2AE64 and H2BE113) (Figures 3B and 3C). Notably, both K364del and R377H mutations led to a reduction in crosslinking across experiments (Figures 3B–3D). Interestingly, the interaction was only partially antagonized in competition experiments employing LANA peptide, which is known to engage the canonical acidic patch region (Figures S3A–S3C)