IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Derepression by depolymerization; structural insights into the regulation of Yan by Mae. Derepression by depolymerization; structural insights into the regulation of Yan by Mae. Cell (0092-8674) 2004 Qiao F., Song H., Kim CA., Sawaya MR., Hunter JB., Gingery M., Rebay I., Courey AJ., Bowie JU. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Qiao F., Song H., Kim CA., Sawaya MR., Hunter JB., Gingery M., Rebay I., Courey AJ., Bowie JU. PDBe - Data obtained from the Protein Data Bank Europe Cell (0092-8674) 2004 pok_drome Ets DNA-binding protein pokkuri aop pok Yan CG3166 Protein yan Protein anterior open protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSKMKMLPVQLSLNSLNPGIWSDVLWRCPPAPSSQLAELKTQLPPSLPSDPRLWSREDVLVFLRFCVREFDLPKLDFDLFQMNGKALCLLTRADFGHRCPGAGDVLHNVLQMLIIESHMMQWHLPNSPVTPTSRYPLSPHSHPPTPTWPPLNAPPENSPFHSSAHSLAGHHFMAPNSVTLSPPPSVDSQASSPPQAPYQNGGATGAAPGSAGGSAPAAGGATNTSNPTSSSASSTGSNGSQPNIMPMKGISSASSNHSDSEEEYSETSGGVSKMPPAPLSYSTASPPGTPILKDIKPNWTQQLTNSFVNSWSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLPQKLTLDNTAGPVVTPAGGSISAPTTPSYMYKAKREFFPENSEPNTNGRLLWDFLQQLLNDRNQKYSDLIAWKCRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQFLRNPTELKNIKNISLLRQSTPANGNGGSPSMPQGSSQAPGSPAGQNWNPQQQSQQQQQSPQRPASRNGPMSLPAVAAVAAAAAAAYGPPPTSPLFMHAINGAFHYLSAAAAGPPPNSPALNTPSAVGGPDKFQFHPLKLENGSGSGSESAGEDLKPTDLSVSSKSTATSNEDCYPLIRNADGLTTIKLIRYNEHQVAASPAGQSPKHDDQQAGASNASSSPRPMDQASEQAQPVPMESDCNGGESEDSFRHMQQ 25D36A652BA67176 q7k119_drome edl mae Dmel_CG15085 CG15085 Dmel\CG15085 EDL Edl MAE Mae anon-WO02077276.2 anon-WO02077276.3 l(2)k06602 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQVESSYTKYAGRVPPLDLTQVNGGQDLWGGNGGGNNASARRHLHHPYQMLDKCRGGVTLISASSAISSTSNSSDDNNNRLMSADDGTTSLLHPLGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMALLS 223FA744AA669D2B aop-edl-1 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction dimeric, multimeric working 76.800%, free 74.500% 2.07A