IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The role of tryptophan 314 in the conformational changes of beta1,4-galactosyltransferase-I. The role of tryptophan 314 in the conformational changes of beta1,4-galactosyltransferase-I. J. Mol. Biol. (0022-2836) 2003 Ramasamy V., Ramakrishnan B., Boeggeman E., Qasba PK. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ramasamy V., Ramakrishnan B., Boeggeman E., Qasba PK. PDBe - Data obtained from the Protein Data Bank Europe J. Mol. Biol. (0022-2836) 2003 b4gt1_bovin Beta-1,4-galactosyltransferase 1 B4GALT1 GALT GGTB2 UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1 UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1 Neolactotriaosylceramide beta-1,4-galactosyltransferase Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase Lactose synthase A protein N-acetyllactosamine synthase Nal synthase protein protein bovin Bos taurus (Bovine) Bovine MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPLQGSSHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTSAPVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS FABF94E74E0C6F81 lalba_mouse Alpha-lactalbumin Lalba Lactose synthase B protein protein protein mouse Mus musculus Mouse MMHFVPLFLVCILSLPAFQATELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEYGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMCSEKLEQWRCEKP 0322892711FF4309 b4galt1-lalba-9 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction dimeric, multimeric working 79.300%, free 74.700% 2.3A