IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Distinct molecular mechanism for initiating TRAF6 signalling. Distinct molecular mechanism for initiating TRAF6 signalling. Nature (0028-0836) 2002 Ye H., Arron JR., Lamothe B., Cirilli M., Kobayashi T., Shevde NK., Segal D., Dzivenu OK., Vologodskaia M., Yim M., Du K., Singh S., Pike JW., Darnay BG., Choi Y., Wu H. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ye H., Arron JR., Lamothe B., Cirilli M., Kobayashi T., Shevde NK., Segal D., Dzivenu OK., Vologodskaia M., Yim M., Du K., Singh S., Pike JW., Darnay BG., Choi Y., Wu H. PDBe - Data obtained from the Protein Data Bank Europe Nature (0028-0836) 2002 tnr5_human Tumor necrosis factor receptor superfamily member 5 CD40L receptor B-cell surface antigen CD40 Bp50 CDw40 CD40 TNFRSF5 protein protein human Homo sapiens Human MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ DIP protein P25942 original sequence version: 156 BC8776EC2C4A5680 traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV DIP protein Q9Y4K3 original sequence version: 154 DIP protein Q9Y4K3 original sequence version: 91 DIP protein Q9Y4K3 original sequence version: 114 DIP protein Q9Y4K3 original sequence version: 118 DIP protein Q9Y4K3 original sequence version: 140 DIP protein Q9Y4K3 original sequence version: 159 DIP protein Q9Y4K3 original sequence version: 132 DIP protein Q9Y4K3 original sequence version: 158 DIP protein Q9Y4K3 original sequence version: 171 DIP protein Q9Y4K3 original sequence version: 117 DIP protein Q9Y4K3 original sequence version: 113 5AB9C255CCFEE749 cd40-traf6-2 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction dimeric, multimeric working 79.700%, free 74.200% 1.8A