IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mutations changing the kinetics of class II MHC peptide exchange. Mutations changing the kinetics of class II MHC peptide exchange. Immunity (1074-7613) 2001 Wilson N., Fremont D., Marrack P., Kappler J. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wilson N., Fremont D., Marrack P., Kappler J. PDBe - Data obtained from the Protein Data Bank Europe Immunity (1074-7613) 2001 ha22_mouse H-2 class II histocompatibility antigen, E-K alpha chain protein protein mouse Mus musculus Mouse MATIGALVLRFFFIAVLMSSQKSWAIKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEEKTLLPETKENVVCALGLFVGLVGIVVGIILIMKGIKKRNVVERRQGAL 144EEA3AB1EF3724 hbb2_mouse Hemoglobin subunit beta-2 Hemoglobin beta-2 chain Beta-2-globin Hemoglobin beta-minor chain Hbb-b2 protein protein mouse Mus musculus Mouse MVHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH 1FABBDC2D0ABC4FD ha22-hbb_b2-1 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction tetrameric, multimeric working 77.100%, free 73.00% 2.4A