UniProt UniProt http://www.uniprot.org Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. 293T cell havee been transfected with myc-Dbl-1 or myc-pDbl and HA-NME1/Nm23-H1 plasmids. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunostaining immunostaining Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions human-dg75 Homo sapiens Burkitt lymphoma cell line DG-75 dg75 Burkitt lymphoma cell line DG-75 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. 293T cell havee been transfected with myc-Dbl-1 or myc-pDbl and HA-NME1/Nm23-H1 plasmids. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. DG-75 cell lysate has been incubated with GST-bound NME1/Nm23-H1. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. 293T cell havee been transfected with Dbl-1 or pDbl plasmids and cell lysates have been incubated with GST-bound NME1/Nm23-H1. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1. Int. J. Cancer (0020-7136) 2008 imex curation Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu B-cell lymphoma cDNA jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Murakami M., Meneses PI., Knight JS., Lan K., Kaul R., Verma SC., Robertson ES. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. erle@mail.med.upenn.edu Accepted 2008-OCT-22 by JYOTI. B-cell lymphoma cDNA Int. J. Cancer (0020-7136) 2008 jyoti Only protein-protein interactions imex curation p10911-pro_0000030434 DBL-transforming protein MCF2 DBL Proto-oncogene MCF-2 protein protein human Homo sapiens Human HVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVKGDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQNDEKQQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEENRPLMRPVSEMALLY 498 925 D3602CE568B50555 ndka_human Nucleoside diphosphate kinase A Tumor metastatic process-associated protein Metastasis inhibition factor nm23 Granzyme A-activated DNase NME1 NDPKA NM23 NM23-H1 protein protein human Homo sapiens Human MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE AAE9C0DF63CB70A1 mcf2_human Proto-oncogene DBL MCF2 DBL Proto-oncogene MCF-2 protein protein human Homo sapiens Human MAEANPRRGKMRFRRNAASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVHDMETAFDGFWEKHQLKMEQYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKAQFVILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQARQCCDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAGFRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQGKKTWRQNQSNLKIEVVPDCQEKRSSGPSSSLDNGNSLDVLKNHVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVKGDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQNDEKQQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEENRPLMRPVSEMALLY 96233C7AFC85D637 nme1-mcf2 9 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association no figure nme1-mcf2-1 8 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 1A nme1-mcf2-2 8 12 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 1A nme1-mcf2-3 7 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 1b nme1-mcf2-4 7 12 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 1B nme1-mcf2-5 1 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association 1c nme1-mcf2-6 1 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association 1C mcf2-nme1-1 4 12 unspecified role unspecified role bait bait region DBL-transforming protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association 1d nme1-mcf2-7 5 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 2a nme1-mcf2-8 3 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 2c mcf2-nme1-2 3 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association 2b nme1-mcf2-9 6 10 unspecified role unspecified role neutral component neutral component human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role neutral component neutral component human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization 3 nme1-mcf2-10 2 10 unspecified role unspecified role neutral component neutral component chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 11 unspecified role unspecified role neutral component neutral component chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 colocalization colocalization 4 NME1/Nm23-H1 mutations his118phe and pro96ser did not change the colocalization.