IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Mol. Cell. Biol. (0270-7306) 2007 imex curation Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu 01-April-2008: Contacted by JYOTI. Arabidopsis seedling cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu Accepted 2008-MAR-5 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Mol. Cell. Biol. (0270-7306) 2007 imex curation Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu 01-April-2008: Contacted by JYOTI. Arabidopsis seedling cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu Accepted 2008-MAR-5 by CDEROW. 01-April-2008: Contacted by JYOTI. Arabidopsis seedling cDNA library Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Mol. Cell. Biol. (0270-7306) 2007 imex curation Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu 01-April-2008: Contacted by JYOTI. Arabidopsis seedling cDNA library Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu Accepted 2008-MAR-5 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Mol. Cell. Biol. (0270-7306) 2007 imex curation Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu 01-April-2008: Contacted by JYOTI. Arabidopsis seedling cDNA library Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress tap tandem affinity purification TAP TAP tap fingerprinting peptide massfingerprinting fingerprinting Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Transgenic arabisopsis plants expressing TAP tagged SOS2 protein were treated with 150 mM NaCl for 24 h (stressed) or without salt treatment (unstressed) prior to assay. jian-kang.zhu@ucr.edu Accepted 2008-MAR-5 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Interaction of SOS2 with NDPK2 and catalases reveals a point of connection between salt stress and H2O2 signaling in Arabidopsis. Mol. Cell. Biol. (0270-7306) 2007 imex curation Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu 01-April-2008: Contacted by JYOTI. Arabidopsis seedling cDNA library Only protein-protein interactions in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Verslues PE., Batelli G., Grillo S., Agius F., Kim YS., Zhu J., Agarwal M., Katiyar-Agarwal S., Zhu JK. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. jian-kang.zhu@ucr.edu Accepted 2008-MAR-5 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation ndk2_arath Nucleoside diphosphate kinase II, chloroplastic NDPK2 At5g63310 MDC12.28 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVGATVVSKWTPLCVASPPERNSASLNPHCSPARVNFRTALAAFRPQFRLFSRNSASRRRLRASSSAESGIFLPHLVASMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE E9EE97A77942E5EA cipko_arath CBL-interacting serine/threonine-protein kinase 24 SNF1-related kinase 3.11 Protein SALT OVERLY SENSITIVE 2 CIPK24 SnRK3.11 SOS2 At5g35410 F6I13.1 K21B8.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTKKMRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWFRLNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENVERNDEGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWRATEGIPKSEILRTITF DIP protein Q9LDI3 original sequence version: 90 99FDF3A778E1093D cnbl4_arath Calcineurin B-like protein 4 Protein SALT OVERLY SENSITIVE 3 CBL4 SOS3 At5g24270 MOP9.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGCSVSKKKKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEEFQLALFRNRNRRNLFADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGFIEREELKEMVVALLHESELVLSEDMIEVMVDKAFVQADRKNDGKIDIDEWKDFVSLNPSLIKNMTLPYLKDINRTFPSFVSSCEEEEMELQNVSS DIP protein O81223 original sequence version: 98 DF06C3973748AFF7 cipke_arath CBL-interacting serine/threonine-protein kinase 14 CIPK14 At5g01820 PKS24 SnRK3.15 SR1 SOS2-like protein kinase PKS24 SNF1-related kinase 3.15 Serine/threonine-protein kinase SR1 T20L15.90 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVDSDPVEFPPENRRGQLFGKYEVGKLVGCGAFAKVYHGRSTATGQSVAIKVVSKQRLQKGGLNGNIQREIAIMHRLRHPSIVRLFEVLATKSKIFFVMEFAKGGELFAKVSKGRFCEDLSRRYFQQLISAVGYCHSRGIFHRDLKPENLLLDEKLDLKISDFGLSALTDQIRPDGLLHTLCGTPAYVAPEVLAKKGYDGAKIDIWSCGIILFVLNAGYLPFNDHNLMVMYRKIYKGEFRIPKWTSPDLRRLLTRLLDTNPQTRITIEEIIHDPWFKQGYDDRMSKFHLEDSDMKLPADETDSEMGARRMNAFDIISGSPGFNLSGLFGDARKYDRVERFVSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEVRKRQRAAASGRDLWTDTLRPFFVELVHESDQTDPEPTQVHTTS 319532FEFB7244C8 cipkb_arath CBL-interacting serine/threonine-protein kinase 11 SOS2-like protein kinase PKS5 SNF1-related kinase 3.22 SOS3-interacting protein 4 CIPK11 PKS5 SIP4 SnRK3.22 At2g30360 T9D9.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPEIEIAAGSGDNNDALFGKYELGKLLGCGAFAKVFHARDRRTGQSVAVKILNKKKLLTNPALANNIKREISIMRRLSHPNIVKLHEVMATKSKIFFAMEFVKGGELFNKISKHGRLSEDLSRRYFQQLISAVGYCHARGVYHRDLKPENLLIDENGNLKVSDFGLSALTDQIRPDGLLHTLCGTPAYVAPEILSKKGYEGAKVDVWSCGIVLFVLVAGYLPFNDPNVMNMYKKIYKGEYRFPRWMSPDLKRFVSRLLDINPETRITIDEILKDPWFVRGGFKQIKFHDDEIEDQKVESSLEAVKSLNAFDLISYSSGLDLSGLFAGCSNSSGESERFLSEKSPEMLAEEVEGFAREENLRMKKKKEEEYGFEMEGQNGKFGIGICISRLNDLLVVVEARRRGGDGDCYKEMWNGKLRVQLIRVCDQTSSTNAAI 50C256B3C2B7D900 cata2_arath Catalase-2 CAT2 CAT M4E13.140 At4g35090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLLEEDAIRVGGTNHSHATQDLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI AB622230561FD79B cata3_arath Catalase-3 CAT3 F2D10.40 F5M15.5 At1g20620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLPESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKNLTDEEAKVVGGANHSHATKDLHDAIASGNYPEWKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI 7322B111CFEBF37E sos2-ndpk2 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Using a yeast two-hybrid approach, we screened a λ-ACT Arabidopsis seedling cDNA library for proteins that interacted with the bait protein SOS2. One of the interacting clones was found to encode NDPK2. ndpk2-sos2 3 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction The SOS2-NDPK2 interaction was confirmed in vitro by demonstrating that GST-fusion proteins of NDPK2 1B sos3-sos2-3 3 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction The SOS2-NDPK2 interaction was confirmed in vitro by demonstrating that GST-fusion proteins of NDPK2 or the positive control SOS3 1B snrk3_15-ndpk2 1 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1C Further tests found that NDPK2 interacted with SnRK3.15 but not SnRK3.13 or SnRK3.5 sos2-cat2 1 7 unspecified role unspecified role bait bait Q9LDI3:p.Lys40Asn mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K N Wed May 02 15:52:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40asn' Tue Jun 30 20:23:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys40Asn' 11 unspecified role unspecified role prey prey physical association physical association interaction of SOS2 with both CAT2 and CAT3 was confirmed by yeasttwo hybrid assays 6A sos2-cat3 1 7 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association interaction of SOS2 with both CAT2 and CAT3 was confirmed by yeast two hybrid assays 6B ndpk2-ndpk2 5 6 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 6 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation 3 The authors concluded that "This is consistent with previous reports that wild type NDPK2 exists almost exclusively in a hexameric form (28) and our results imply that SOS2 inhibited autophosphorylation of the NDPK2 hexamer or other multimeric form of NDPK2". SOS2 inhibits NDPK2 autophosphorylation The SOS2 protein and kinase-dead SOS2 inhibited autophosphorylation of NDPK2 protein. Phosphorylation of NDPK2 protein. snrk3_22-snrk3_22 5 10 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 10 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation 3 The authors note that "We also note that SnRK3.22 itself had a much higher autophosphorylation activity (Figure 3C) than that of SOS2". Phosphorylation of SnRK3.22 protein. We also note that SnRK3.22 itself had a much higher autophosphorylation activity (Figure 3C) than that of SOS2 sos2-cat2-cat3 4 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6A , 6B SOS2 interacts with CAT2 and CAT3 LC-MS/MS analysis detected a number of peptides from both CAT2and CAT3 in protein complexes isolated from salt-stressed plants but not unstressed plants. The authors concluded " salt stress may be required to promote interaction between SOS2 and the CAT2 CAT3 proteins"|. Pretreatment of plants using with 150 mM NaCl for 24 h stimulated CAT2 interaction. sos2-ndpk2-1 1 6 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A, 2A,2B SOS2 interacts with NDPK2.