IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ NDP kinase 2 interacts with two oxidative stress-activated MAPKs to regulate cellular redox state and enhances multiple stress tolerance in transgenic plants. NDP kinase 2 interacts with two oxidative stress-activated MAPKs to regulate cellular redox state and enhances multiple stress tolerance in transgenic plants. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 Moon H., Lee B., Choi G., Shin D., Prasad DT., Lee O., Kwak SS., Kim DH., Nam J., Bahk J., Hong JC., Lee SY., Cho MJ., Lim CO., Yun DJ. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Moon H., Lee B., Choi G., Shin D., Prasad DT., Lee O., Kwak SS., Kim DH., Nam J., Bahk J., Hong JC., Lee SY., Cho MJ., Lim CO., Yun DJ. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 NDP kinase 2 interacts with two oxidative stress-activated MAPKs to regulate cellular redox state and enhances multiple stress tolerance in transgenic plants. NDP kinase 2 interacts with two oxidative stress-activated MAPKs to regulate cellular redox state and enhances multiple stress tolerance in transgenic plants. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 Moon H., Lee B., Choi G., Shin D., Prasad DT., Lee O., Kwak SS., Kim DH., Nam J., Bahk J., Hong JC., Lee SY., Cho MJ., Lim CO., Yun DJ. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Moon H., Lee B., Choi G., Shin D., Prasad DT., Lee O., Kwak SS., Kim DH., Nam J., Bahk J., Hong JC., Lee SY., Cho MJ., Lim CO., Yun DJ. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 mpk6_arath Mitogen-activated protein kinase 6 MPK6 At2g43790 F18O19.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ 296D2BD753C6DDA4 mpk3_arath Mitogen-activated protein kinase 3 MPK3 At3g45640 T6D9.4 F9K21.220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTGGGQYTDFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTETNELVAMKKIANAFDNHMDAKRTLREIKLLRHLDHENIIAIRDVVPPPLRRQFSDVYISTELMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANIIHRDLKPSNLLLNANCDLKICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPMAIDLVDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQQPLDEEQIKEMIYQEAIALNPTYG 6992A7D97F3C9841 ndk2_arath Nucleoside diphosphate kinase II, chloroplastic NDPK2 At5g63310 MDC12.28 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVGATVVSKWTPLCVASPPERNSASLNPHCSPARVNFRTALAAFRPQFRLFSRNSASRRRLRASSSAESGIFLPHLVASMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE E9EE97A77942E5EA ndpk2-mpk3-1 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association mpk3-ndpk2-2 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association mpk6-ndpk2-1 1 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association