IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel role for KLF14 in T regulatory cell differentiation. A novel role for KLF14 in T regulatory cell differentiation. Cellular and molecular gastroenterology and hepatology 2015 imex curation Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA., Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA. Diabetes - Interactions investigated in the context of Diabetes Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease The origins of His-KLF14 in figure 8 are not given and the authors did not reply to a request for information. However this construct has been assumed to be of Murine origin. faubion.william@mayo.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA. Diabetes - Interactions investigated in the context of Diabetes Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Interactions with H3K9me3 have not been included due to antibody non-specificity. Regulatory T cells (CD4+) CD25+ faubion.william@mayo.edu Accepted 2015-AUG-11 by ORCHARD Cellular and molecular gastroenterology and hepatology 2015 imex curation A novel role for KLF14 in T regulatory cell differentiation. A novel role for KLF14 in T regulatory cell differentiation. Cellular and molecular gastroenterology and hepatology 2015 imex curation Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA., Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA. Diabetes - Interactions investigated in the context of Diabetes Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease The origins of His-KLF14 in figure 8 are not given and the authors did not reply to a request for information. However this construct has been assumed to be of Murine origin. faubion.william@mayo.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA. Diabetes - Interactions investigated in the context of Diabetes Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Interactions with H3K9me3/me2 have not been included due to antibody non-specificity. naive CD4+ T cells faubion.william@mayo.edu Accepted 2015-AUG-11 by ORCHARD Cellular and molecular gastroenterology and hepatology 2015 imex curation cbx3_mouse Chromobox protein homolog 3 Cbx3 Heterochromatin protein 1 homolog gamma Modifier 2 protein M32 protein protein mouse Mus musculus Mouse MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEDFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ DIP protein P23198 original sequence version: 123 DIP protein P23198 original sequence version: 121 DIP protein P23198 original sequence version: 111 2FF3AD53B883E27E cbx1_mouse Chromobox protein homolog 1 Cbx1 Cbx Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 protein protein mouse Mus musculus Mouse MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN DIP protein P83917 original sequence version: 93 BE687AF9C66E48E3 foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse klf14_mouse Krueppel-like factor 14 Klf14 protein protein mouse Mus musculus Mouse MSAAVACLDYFAAECLVSMSTRAVLHRRATDPEGASAAAVSEVGAVSRESAGKGTGSRGVLWIPPVLQVPTPSPGEGDGAPHLLAASALADLSCGAREDFREDSEEAPCASTSCFEPTWCSSPTGGSEPTQAFFEDELSDAESSCSDSAILDAPEASEEPDDSGEVPEGPPGARPAPSTGPTYRRRQITPASKRHQCSFHGCNKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRPEPPPPAMVESSGSDSSSSSGQETSFTACL 5459637FFC0061BE suv91_mouse Histone-lysine N-methyltransferase SUV39H1 Suv39h1 Suv39h Suppressor of variegation 3-9 homolog 1 Position-effect variegation 3-9 homolog Histone H3-K9 methyltransferase 1 protein protein mouse Mus musculus Mouse MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGVSKKNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDSENTWEPRQNLKCIRVLKQFHKDLERELVRRHRRSKPPRHLDPNLANYLVQKAKQRRALQRWEQELNAKRSHLGRITVENEVDLDGPPRSFVYINEYRVGEGITLNQVAVGCECQDCLLAPTGGCCPGASLHKFAYNDQGQVRLKAGQPIYECNSRCCCGYDCPNRVVQKGIRYDLCIFRTNDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIWAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTTACRKYLF DIP protein O54864 original sequence version: 130 DIP protein O54864 original sequence version: 109 6B690F4FE7FD997C klf14-foxp3-1 2 5 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 8 The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. Q19A41 decreases expression at RNA level of ENSMUSG00000039521 Q19A41 decreases expression at protein level of ENSMUSG00000039521 suv39h1-foxp3-1 2 5 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association 9i The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. P01137 increases binding of O54864 to ENSMUSG00000039521 Q19A41 increases binding of O54864 to ENSMUSG00000039521 cbx3-foxp3-1 2 5 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association 9ii The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. P01137 increases binding of P23198 to ENSMUSG00000039521 Q19A41 increases binding of P23198 to ENSMUSG00000039521 cbx3-foxp3-2 2 5 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association 9iii The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. P01137 increases binding of P83917 to ENSMUSG00000039521 Q19A41 increases binding of P83917 to ENSMUSG00000039521 suv39h1-foxp3-2 1 5 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 11 The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. Q19A41 increases binding of O54864 to ENSMUSG00000039521 cbx3-foxp3-3 1 5 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association Fig. 11 The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. Q19A41 increases binding of O54864 to ENSMUSG00000039521