IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel AP-1/miR-101 regulatory feedback loop and its implication in the migration and invasion of hepatoma cells. A novel AP-1/miR-101 regulatory feedback loop and its implication in the migration and invasion of hepatoma cells. Nucleic Acids Res. (0305-1048) 2014 imex curation Liu J.J., Lin X.J., Yang X.J., Zhou L., He S., Zhuang S.M., Yang J. IBD - Inflammatory bowel disease Should/can the indirect effects of TPA on miR-101-2 and MMP1 RNA levels and c-Fos and c-Jun RNA and protein levels be captured here? TPA is not used as an agonist in the ChIP but cells are incubated with TPA prior to the experiment... lssyje@mail.sysu.edu.cn,zhuangshimei@163.com,lsszsm@mail.sysu.edu.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag perox activity tag visualisation by peroxidase activity tag perox activity Liu J.J., Lin X.J., Yang X.J., Zhou L., He S., Zhuang S.M., Yang J. IBD - Inflammatory bowel disease Should/can the indirect effects of TPA on miR-101-2 and MMP1 RNA levels and c-Fos and c-Jun RNA and protein levels be captured here? TPA is not used as an agonist in the ChIP but cells are incubated with TPA prior to the experiment... Nuclear extracts were prepared from HepG2 cells treated with 12-O-tetradecanoylphorbol-13-acetate (TPA) (CHEBI:37537). lssyje@mail.sysu.edu.cn,zhuangshimei@163.com,lsszsm@mail.sysu.edu.cn Accepted 2014-DEC-24 by MGT Nucleic Acids Res. (0305-1048) 2014 Only protein-protein interactions imex curation A novel AP-1/miR-101 regulatory feedback loop and its implication in the migration and invasion of hepatoma cells. A novel AP-1/miR-101 regulatory feedback loop and its implication in the migration and invasion of hepatoma cells. Nucleic Acids Res. (0305-1048) 2014 imex curation Liu J.J., Lin X.J., Yang X.J., Zhou L., He S., Zhuang S.M., Yang J. IBD - Inflammatory bowel disease Should/can the indirect effects of TPA on miR-101-2 and MMP1 RNA levels and c-Fos and c-Jun RNA and protein levels be captured here? TPA is not used as an agonist in the ChIP but cells are incubated with TPA prior to the experiment... lssyje@mail.sysu.edu.cn,zhuangshimei@163.com,lsszsm@mail.sysu.edu.cn 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Liu J.J., Lin X.J., Yang X.J., Zhou L., He S., Zhuang S.M., Yang J. IBD - Inflammatory bowel disease Should/can the indirect effects of TPA on miR-101-2 and MMP1 RNA levels and c-Fos and c-Jun RNA and protein levels be captured here? TPA is not used as an agonist in the ChIP but cells are incubated with TPA prior to the experiment... HepG2 cells were treated with 12-O-tetradecanoylphorbol-13-acetate (TPA) (CHEBI:37537) (40 ng/ml) for 4 hours before cross-linking with formaldehyde. lssyje@mail.sysu.edu.cn,zhuangshimei@163.com,lsszsm@mail.sysu.edu.cn Accepted 2014-DEC-24 by MGT Nucleic Acids Res. (0305-1048) 2014 Only protein-protein interactions imex curation jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 mir-101-2_human_ap1-site-b_dna-probe Human microRNA-101-2 gene promoter non-canonical AP1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TGTATGTGTGTCACATTTGAAGTCACCAGTT mir-101-2_human_ap1-site-a_dna-probe Human microRNA-101-2 gene promoter canonical AP1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TCCCACTGACTCATTGGAAGAGCTGTGTGACTCAGTGTAT mmp1_human_gene Interstitial collagenase (MMP1) human gene gene gene human Homo sapiens Human fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 mir-101-2_human_gene microRNA-101-2 (miR-101-2) human gene gene gene human Homo sapiens Human jun-mir_101_2-1 2 8 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association Fig. 3a, 3b anti-c-Jun siRNA P05412 increases expression at RNA level of ENSG00000199065 CHEBI:37537 indirectly increases expression at RNA level of P05412 CHEBI:37537 indirectly increases expression at protein level of P05412 fos-mir_101_2-1 2 8 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 3a, 3b anti-c-Fos siRNA P01100 increases expression at RNA level of ENSG00000199065 CHEBI:37537 indirectly increases expression at RNA level of ENSG00000199065 CHEBI:37537 indirectly increases expression at RNA level of P01100 CHEBI:37537 indirectly increases expression at protein level of P01100 jun-mmp1-1 2 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association Fig. 3a, 3b anti-c-Jun siRNA fos-mmp1-1 2 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 3a, 3b anti-c-Fos siRNA CHEBI:37537 indirectly increases expression at RNA level of ENSG00000196611 mir_101_2-fos-1 1 5 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). physical association physical association Fig. 3d mir_101_2-jun-1 1 5 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). physical association physical association Fig. 3d mir_101_2-jun-2 1 3 unspecified role unspecified role prey prey human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). 4 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3d mir_101_2-fos-2 1 7 unspecified role unspecified role prey prey human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). 4 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3d