IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. The Journal of biological chemistry 2014 imex curation de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu Accepted 2016-FEB-11 AT 16:55 GMT AT 16:55 GMT by PPORRAS The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. The Journal of biological chemistry 2014 imex curation de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. ZF (ZincFinger) region of KLF14 coordinates taken from Ref13. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu Accepted 2016-FEB-11 AT 16:55 GMT AT 16:55 GMT by PPORRAS The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. The Journal of biological chemistry 2014 imex curation de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. HUVECs (human umbilical vein endothelial cells) were infected with FGFR1 adenovirus and stimulated with FGF2. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu Accepted 2016-FEB-11 AT 16:55 GMT AT 16:55 GMT by PPORRAS The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. The Journal of biological chemistry 2014 imex curation de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu Accepted 2016-FEB-11 AT 16:55 GMT AT 16:55 GMT by PPORRAS The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. New role for Kruppel-like factor 14 as a transcriptional activator involved in the generation of signaling lipids. The Journal of biological chemistry 2014 imex curation de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography de Assuncao TM., Lomberk G., Cao S., Yaqoob U., Mathison A., Simonetto DA., Huebert RC., Urrutia RA., Shah VH. IBD - Inflammatory bowel disease Interaction using anti-H3 antibodies have not been annotated due to lack of target specificity. I have already curated pmid:19088080 - Sandra is checker. KLF14 is of Human origin - see reference 13, figure 6A (pmid:19088080). urrutia.raul@mayo.edu,shah.vijay@mayo.edu Accepted 2016-FEB-11 AT 16:55 GMT AT 16:55 GMT by PPORRAS The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation sphk1_promoter_probe ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human CCGGGAGCGCGGGGCGGAGCCAGGCCGGCG sphk1_human_gene Sphingosine kinase 1 SPHK1 SPHK SPK gene gene human Homo sapiens Human ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 sp6_human Transcription factor Sp6 SP6 KLF14 Krueppel-like factor 14 protein protein human Homo sapiens Human MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQHLLGPPDGAKALEVAAPESQGLDSSLDGAARPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAGAASGEGKAGGAVEPPGGKGKREAEGSVAPSN 1F4355CFB75206E8 hist1h4a-sphk1-1 3 7 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait lys9 n6aclys N6-acetyl-L-lysine (2S)-6-acetamido-2-aminohexanoic acid 6-acetylamino-2-aminohexanoic acid 6-acetylazanyl-2-aminohexanoic acid MOD_RES N6-acetyllysine N(zeta)-acetyllysine N6-acetyl-L-lysine N6-acetylated L-lysine epsilon-acetyllysine Acetyl Acetylation N6AcLys acetylk certain certain sequence position certain certain certain sequence position certain association association 6A,7 FGF2 no species for FGF2 or would have added a causality statement Q8TD94 increases binding of P62805 to ENSG00000176170 Figure 7: the molecule "H3K8ac" has been assumed to refer to "H4K8ac", as stated in the figure legend, as there is no lysine residue at position 8/9 in any Histone H3. ep300-sphk1-1 3 7 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association 8A FGF2 no species for FGF2 or would have added a causality statement sp6-sphk1-1 1 7 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5A Q3SY56 increases expression at RNA level of ENSG00000176170 Q3SY56 increases expression at protein level of ENSG00000176170 Q09472 increases the binding of Q3SY56 to ENSG00000176170 causality from fig 4,8 sphk1_promoter_probe-sp6-1 5 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined G_G_G_G11-14A_A_A_A,G_G16-17A_A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain GGGG AAAA certain certain sequence position certain certain certain sequence position certain GG AA chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5B Pablo: I have combined the mutation - it contains two groups of sequential mutations- so I have not entered as "non-sequential" mutation. Hope this is OK. sphk1_promoter_probe-sp6-2 4 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association 5B hist1h4a-sphk1-2 1 7 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait lys9 n6aclys N6-acetyl-L-lysine (2S)-6-acetamido-2-aminohexanoic acid 6-acetylamino-2-aminohexanoic acid 6-acetylazanyl-2-aminohexanoic acid MOD_RES N6-acetyllysine N(zeta)-acetyllysine N6-acetyl-L-lysine N6-acetylated L-lysine epsilon-acetyllysine Acetyl Acetylation N6AcLys acetylk certain certain sequence position certain certain certain sequence position certain association association 6 B Q8TD94 increases binding of P62805 to ENSG00000176170 KLF14-His ep300-sphk1-2 1 7 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association 8A KLF14 Q8TD94 increases binding of Q09472 to ENSG00000176170. Q8TD94 increases expression at RNA level of ENSG00000176170 Q8TD94 increases expression at protein level of ENSG00000176170 sp6-ep300-1 2 10 unspecified role unspecified role bait bait possible_flag_or_his_tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association 8D The image legend states: "HEK 293 cells were cotransfected with His tag-KLF14 or His tag-EV and p300." However text shown on the image states "IP:Flag" which might indicate the presence of a Flag rather than a His tag.